• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens sodium channel, non-voltage-gated 1, beta subunit (SCNN1B), mRNA.


RefSeq Accession Definition Services Price Order
NM_000336 Homo sapiens sodium channel, non-voltage-gated 1, beta subunit (SCNN1B), mRNA. ORF Sequence $557.67
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000336.2, 124301195
Length 2597 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens sodium channel, non-voltage-gated 1, beta subunit (SCNN1B), mRNA.
Product amiloride-sensitive sodium channel subunit beta
Comment

Summary: Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the beta subunit, and mutations in this gene have been associated with pseudohypoaldosteronism type 1 (PHA1), and Liddle syndrome. [provided by RefSeq, Apr 2009].

RefSeq NP_000327.2
CDS 177..2099
Misc Feature(1)237..2045
Misc Feature(2)237..2045
Misc Feature(3)330..401
Misc Feature(4)1719..1811
Exon (1)1..168
Gene:SCNN1B
Gene Synonym:BESC1; ENaCb; ENaCbeta; SCNEB
Exon (2)169..487
Gene:SCNN1B
Gene Synonym:BESC1; ENaCb; ENaCbeta; SCNEB
Exon (3)488..761
Gene:SCNN1B
Gene Synonym:BESC1; ENaCb; ENaCbeta; SCNEB
Exon (4)762..952
Gene:SCNN1B
Gene Synonym:BESC1; ENaCb; ENaCbeta; SCNEB
Exon (5)953..1056
Gene:SCNN1B
Gene Synonym:BESC1; ENaCb; ENaCbeta; SCNEB
Exon (6)1057..1220
Gene:SCNN1B
Gene Synonym:BESC1; ENaCb; ENaCbeta; SCNEB
Exon (7)1221..1328
Gene:SCNN1B
Gene Synonym:BESC1; ENaCb; ENaCbeta; SCNEB
Exon (8)1329..1446
Gene:SCNN1B
Gene Synonym:BESC1; ENaCb; ENaCbeta; SCNEB
Exon (9)1447..1522
Gene:SCNN1B
Gene Synonym:BESC1; ENaCb; ENaCbeta; SCNEB
Exon (10)1523..1580
Gene:SCNN1B
Gene Synonym:BESC1; ENaCb; ENaCbeta; SCNEB
Exon (11)1581..1642
Gene:SCNN1B
Gene Synonym:BESC1; ENaCb; ENaCbeta; SCNEB
Exon (12)1643..1718
Gene:SCNN1B
Gene Synonym:BESC1; ENaCb; ENaCbeta; SCNEB
Exon (13)1719..2597
Gene:SCNN1B
Gene Synonym:BESC1; ENaCb; ENaCbeta; SCNEB
Translation MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFA ALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELME AVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSAS EKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSY PGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILD IGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSP CTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDF PDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERD QSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEF GEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPN TGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
80+dbSNP:
80+c, gdbSNP:182838090
196+c, tdbSNP:139455317
207+c, gdbSNP:72654320
230+c, tdbSNP:144142075
266+c, tdbSNP:61741877
285+a, gdbSNP:137852706
297+a, gdbSNP:146431954
298+c, tdbSNP:17853594
323+a, gdbSNP:80027401
357+a, gdbSNP:72654321
395+a, cdbSNP:151171880
421+c, gdbSNP:35731153
431+a, gdbSNP:72654322
444+a, gdbSNP:150466803
455+c, tdbSNP:238547
456+a, gdbSNP:188052279
458+c, tdbSNP:139950628
482+c, tdbSNP:146909992
604+dbSNP:
604+c, tdbSNP:199810483
630+c, tdbSNP:199832551
642+c, tdbSNP:139310448
695+a, cdbSNP:201804824
713+a, cdbSNP:143007171
793+dbSNP:
793+a, gdbSNP:201279350
839+a, gdbSNP:143629145
864+a, gdbSNP:200579812
875+c, gdbSNP:185554955
902+c, tdbSNP:148125384
914+c, tdbSNP:141889317
951+c, tdbSNP:72654326
962+dbSNP:
962+a, gdbSNP:150781093
976+c, tdbSNP:137852709
979+a, gdbSNP:138004955
1033+c, tdbSNP:142531781
1039+a, gdbSNP:137852712
1055+c, tdbSNP:250563
1056+a, gdbSNP:72654338
1071+dbSNP:
1071+c, tdbSNP:35728064
1074+g, tdbSNP:182297172
1079+a, gdbSNP:149667567
1081+a, gdbSNP:201115205
1117+c, gdbSNP:1047229
1140+a, gdbSNP:199921576
1181+c, tdbSNP:13306633
1182+a, gdbSNP:200278167
1185+a, gdbSNP:144436826
1208+c, tdbSNP:148438164
1217+c, tdbSNP:201864704
1218+a, gdbSNP:61759921
1223+dbSNP:
1223+c, tdbSNP:1129412
1226+a, gdbSNP:142551001
1233+c, tdbSNP:150949875
1263+a, gdbSNP:142550343
1281+a, cdbSNP:137852711
1288+a, gdbSNP:144780745
1312+c, tdbSNP:41278184
1338+dbSNP:
1338+c, tdbSNP:61729788
1339+a, gdbSNP:201575688
1366+g, tdbSNP:61729789
1391+a, gdbSNP:150414095
1397+c, tdbSNP:2303156
1404+c, tdbSNP:200401219
1405+a, gdbSNP:200966246
1429+a, gdbSNP:201649568
1433+a, gdbSNP:2303155
1451+dbSNP:
1451+c, tdbSNP:200416547
1461+c, gdbSNP:199767322
1475+c, tdbSNP:149172890
1476+a, gdbSNP:201330438
1500+a, gdbSNP:143302160
1501+g, tdbSNP:1799980
1504+c, tdbSNP:142572398
1552+dbSNP:
1552+c, tdbSNP:201369319
1577+c, tdbSNP:74012901
1595+dbSNP:
1595+c, tdbSNP:193211556
1621+c, gdbSNP:35754869
1644+dbSNP:
1644+a, gdbSNP:200237728
1690+a, gdbSNP:138784278
1697+g, tdbSNP:201369710
1721+dbSNP:
1721+c, tdbSNP:61759916
1736+c, gdbSNP:146440372
1791+a, gdbSNP:137852710
1795+c, tdbSNP:150726229
1811+c, tdbSNP:139050851
1812+a, gdbSNP:112069765
1864+a, gdbSNP:149868979
1868+a, gdbSNP:34842432
1870+a, gdbSNP:13306627
1872+c, tdbSNP:137852704
1879+a, cdbSNP:72654354
1882+c, tdbSNP:140927806
1907+c, tdbSNP:61759923
1914+a, gdbSNP:80311498
1926+a, gdbSNP:72654355
1933+c, tdbSNP:147926991
1941+a, gdbSNP:61759926
1950+c, tdbSNP:188536989
1956+a, tdbSNP:34464088
1957+c, tdbSNP:1799979
1958+a, gdbSNP:13306628
1966+a, gdbSNP:140945152
1979+c, tdbSNP:140391362
2025+c, tdbSNP:137852708
2029+c, g, tdbSNP:137852705
2034+c, tdbSNP:137852707
2059+a, tdbSNP:72654356
2063+c, tdbSNP:61759917
2064+a, gdbSNP:72654357
2070+a, gdbSNP:140609339
2080+a, gdbSNP:13306629
2086+g, tdbSNP:200166680
2099+a, tdbSNP:13306630
2111+c, tdbSNP:1047236
2122+c, tdbSNP:1063153
2123+a, gdbSNP:34603451
2162+a, cdbSNP:1047237
2166+a, gdbSNP:72654358
2193+a, gdbSNP:72654359
2245+a, gdbSNP:13306631
2256+c, tdbSNP:181213527
2450+c, tdbSNP:111639684
2499+a, gdbSNP:150386633
2544+g, tdbSNP:11545812
2564+c, tdbSNP:72654360
2589+a, cdbSNP:138092568
Gene SymbolSCNN1B
Gene SynonymBESC1; ENaCb; ENaCbeta; SCNEB
Chromosome16
Locus Map16p12.2-p12.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000336 Homo sapiens sodium channel, non-voltage-gated 1, beta subunit (SCNN1B), mRNA. Full Length $753.13
ORF Sequence $557.67
Title A family with Liddle syndrome caused by a novel missense mutation in the PY motif of the beta-subunit of the epithelial sodium channel .
Author Gao,L., Wang,L., Liu,Y., Zhou,X., Hui,R. and Hu,A.
Journal J. Pediatr. 162 (1), 166-170 (2013)
Title Identification of extracellular domain residues required for epithelial Na+ channel activation by acidic pH .
Author Collier,D.M., Peterson,Z.J., Blokhin,I.O., Benson,C.J. and Snyder,P.M.
Journal J. Biol. Chem. 287 (49), 40907-40914 (2012)
Title MicroRNA 16 modulates epithelial sodium channel in human alveolar epithelial cells .
Author Tamarapu Parthasarathy,P., Galam,L., Huynh,B., Yunus,A., Abuelenen,T., Castillo,A., Kollongod Ramanathan,G., Cox,R. Jr. and Kolliputi,N.
Journal Biochem. Biophys. Res. Commun. 426 (2), 203-208 (2012)
Title Effects of rhinovirus infection on the expression and function of cystic fibrosis transmembrane conductance regulator and epithelial sodium channel in human nasal mucosa .
Author Kim,J.H., Kwon,H.J. and Jang,Y.J.
Journal Ann. Allergy Asthma Immunol. 108 (3), 182-187 (2012)
Title Mutations in the amiloride-sensitive epithelial sodium channel in patients with cystic fibrosis-like disease .
Author Azad,A.K., Rauh,R., Vermeulen,F., Jaspers,M., Korbmacher,J., Boissier,B., Bassinet,L., Fichou,Y., des Georges,M., Stanke,F., De Boeck,K., Dupont,L., Balascakova,M., Hjelte,L., Lebecque,P., Radojkovic,D., Castellani,C., Schwartz,M., Stuhrmann,M., Schwarz,M., Skalicka,V., de Monestrol,I., Girodon,E., Ferec,C., Claustres,M., Tummler,B., Cassiman,J.J., Korbmacher,C. and Cuppens,H.
Journal Hum. Mutat. 30 (7), 1093-1103 (2009)
Title Gene structure of the human amiloride-sensitive epithelial sodium channel beta subunit .
Author Saxena,A., Hanukoglu,I., Strautnieks,S.S., Thompson,R.J., Gardiner,R.M. and Hanukoglu,A.
Journal Biochem. Biophys. Res. Commun. 252 (1), 208-213 (1998)
Title Molecular cloning and functional expression of a novel amiloride-sensitive Na+ channel .
Author Waldmann,R., Champigny,G., Bassilana,F., Voilley,N. and Lazdunski,M.
Journal J. Biol. Chem. 270 (46), 27411-27414 (1995)
Title Hypertension caused by a truncated epithelial sodium channel gamma subunit: genetic heterogeneity of Liddle syndrome .
Author Hansson,J.H., Nelson-Williams,C., Suzuki,H., Schild,L., Shimkets,R., Lu,Y., Canessa,C., Iwasaki,T., Rossier,B. and Lifton,R.P.
Journal Nat. Genet. 11 (1), 76-82 (1995)
Title Cloning, chromosomal localization, and physical linkage of the beta and gamma subunits (SCNN1B and SCNN1G) of the human epithelial amiloride-sensitive sodium channel .
Author Voilley,N., Bassilana,F., Mignon,C., Merscher,S., Mattei,M.G., Carle,G.F., Lazdunski,M. and Barbry,P.
Journal Genomics 28 (3), 560-565 (1995)
Title Cloning and expression of the beta- and gamma-subunits of the human epithelial sodium channel .
Author McDonald,F.J., Price,M.P., Snyder,P.M. and Welsh,M.J.
Journal Am. J. Physiol. 268 (5 PT 1), C1157-C1163 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878