Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 2 (SLC2A2), mRNA.
| RefSeq Version | NM_000340.1, 4557850 |
| Length | 3439 bp |
| Structure | linear |
| Update Date | 09-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 2 (SLC2A2), mRNA. |
| Product | solute carrier family 2, facilitated glucose transporter member 2 |
| Comment | Summary: Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor. [provided by RefSeq]. |
| RefSeq | NP_000331.1 |
| CDS | 310..1884 | Exon (1) | 1..324 | Exon (2) | 1..324 | Exon (3) | 325..417 | Exon (4) | 418..680 | Exon (5) | 681..805 | Exon (6) | 806..921 | Exon (7) | 922..1084 | Exon (8) | 1085..1272 | Exon (9) | 1273..1377 | Exon (10) | 1378..1479 | Exon (11) | 1480..1683 | Exon (12) | 1684..3439 |
| Translation | MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYV
INSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGD
TLGRIKAMLVANILSLVGALLMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIA
PTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLGLSGVRAILQSLLLFFCP
ESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSY
RQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNMVFTAVSVFLV
EKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPW
FMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFT
FFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(512) | - | g, a | dbSNP:7637863 |
| 610 | + | a, g | dbSNP:1800572 |
| 638 | + | c, t | dbSNP:5400 |
| 804 | + | c, t | dbSNP:5401 |
| 898 | + | a, g | dbSNP:121909741 |
| 903 | + | a, g | dbSNP:5404 |
| 970 | + | c, t | dbSNP:5405 |
| complement(1089) | - | c, a | dbSNP:76026576 |
| 1168 | + | c, t | dbSNP:121909746 |
| 1210 | + | c, t | dbSNP:121909743 |
| 1386 | + | c, t | dbSNP:5408 |
| complement(1396) | - | c, a | dbSNP:76362149 |
| complement(1401..1402) | - | , g | dbSNP:34066960 |
| 1402 | + | c, t | dbSNP:121909742 |
| complement(1431) | - | g, a | dbSNP:113255143 |
| 1475 | + | c, t | dbSNP:121909747 |
| 1520 | + | c, t | dbSNP:2229608 |
| 1559 | + | c, t | dbSNP:121909744 |
| 1568 | + | a, g | dbSNP:121909745 |
| 1577 | + | a, t | dbSNP:28928874 |
| complement(1604) | - | t, c | dbSNP:75144723 |
| 1741 | + | c, g | dbSNP:5397 |
| 1746 | + | c, t | dbSNP:5398 |
| 1815 | + | a, g | dbSNP:5399 |
| complement(2118) | - | t, g | dbSNP:79424762 |
| complement(2135..2136) | - | , g | dbSNP:35273940 |
| complement(2201) | - | t, g | dbSNP:78515588 |
| complement(2209) | - | t, a | dbSNP:116038320 |
| complement(2240) | - | t, a | dbSNP:7610064 |
| complement(2320) | - | g, c | dbSNP:75382705 |
| complement(2358) | - | t, c | dbSNP:114710971 |
| complement(2360) | - | g, a | dbSNP:75975646 |
| complement(2439..2440) | - | , c | dbSNP:35577271 |
| complement(2609) | - | g, c | dbSNP:79770697 |
| complement(2781) | - | c, a | dbSNP:12330351 |
| complement(2793) | - | g, a | dbSNP:77733690 |
| complement(2804) | - | t, g | dbSNP:56204521 |
| complement(3016) | - | t, g | dbSNP:55669541 |
| complement(3063) | - | t, g | dbSNP:74630881 |
| complement(3091) | - | t, c | dbSNP:28579899 |
| complement(3106) | - | t, a | dbSNP:55989805 |
| complement(3141) | - | g, a | dbSNP:55679742 |
| complement(3233) | - | g, a | dbSNP:112957674 |
| complement(3304) | - | g, a | dbSNP:114911033 |
| Title | Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study . |
| Author | Flachsbart,F., Franke,A., Kleindorp,R., Caliebe,A., Blanche,H., Schreiber,S. and Nebel,A. |
| Journal | Mutat. Res. 694 (1-2), 13-19 (2010) |
| Title | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study . |
| Author | Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S. |
| Journal | Diabetes Care 33 (10), 2250-2253 (2010) |
| Title | Variants at DGKB/TMEM195, ADRA2A, GLIS3 and C2CD4B loci are associated with reduced glucose-stimulated beta cell function in middle-aged Danish people . |
| Author | Boesgaard,T.W., Grarup,N., Jorgensen,T., Borch-Johnsen,K., Hansen,T. and Pedersen,O. |
| Journal | Diabetologia 53 (8), 1647-1655 (2010) |
| Title | L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms . |
| Author | Yokoyama,K., Urashima,M., Ohkido,I., Kono,T., Yoshida,T., Muramatsu,M., Niu,T. and Hosoya,T. |
| Journal | Nephron Clin Pract 115 (4), C237-C243 (2010) |
| Title | [The important role of GLUT2 in intestinal sugar transport and absorption] . |
| Author | Stelmanskan,E. |
| Journal | Postepy Biochem. 55 (4), 385-387 (2009) |
| Title | Human and rat beta cells differ in glucose transporter but not in glucokinase gene expression . |
| Author | De Vos,A., Heimberg,H., Quartier,E., Huypens,P., Bouwens,L., Pipeleers,D. and Schuit,F. |
| Journal | J. Clin. Invest. 96 (5), 2489-2495 (1995) |
| Title | A mutation in the Glut2 glucose transporter gene of a diabetic patient abolishes transport activity . |
| Author | Mueckler,M., Kruse,M., Strube,M., Riggs,A.C., Chiu,K.C. and Permutt,M.A. |
| Journal | J. Biol. Chem. 269 (27), 17765-17767 (1994) |
| Title | Dinucleotide repeat polymorphism at the human GLUT2 locus . |
| Author | Patel,P., Lo,Y.M., Bell,G.I., Turner,R.C. and Wainscoat,J.S. |
| Journal | Nucleic Acids Res. 19 (14), 4017 (1991) |
| Title | CA repeat polymorphism in the glucose transporter GLUT 2 gene . |
| Author | Froguel,P., Zouali,H., Sun,F., Velho,G., Fukumoto,H., Passa,P. and Cohen,D. |
| Journal | Nucleic Acids Res. 19 (13), 3754 (1991) |
| Title | Sequence, tissue distribution, and chromosomal localization of mRNA encoding a human glucose transporter-like protein . |
| Author | Fukumoto,H., Seino,S., Imura,H., Seino,Y., Eddy,R.L., Fukushima,Y., Byers,M.G., Shows,T.B. and Bell,G.I. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 85 (15), 5434-5438 (1988) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |