• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 2 (SLC2A2), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000340 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 2 (SLC2A2), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_000340.1, 4557850
Length 3439 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 2 (SLC2A2), transcript variant 1, mRNA.
Product solute carrier family 2, facilitated glucose transporter member 2 isoform 1
Comment

Summary: This gene encodes an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. The encoded protein mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor. Mutations in this gene are associated with susceptibility to diseases, including Fanconi-Bickel syndrome and noninsulin-dependent diabetes mellitus (NIDDM). Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments and experimental data in the literature (PMID: 11978637).

RefSeq NP_000331.1
CDS 310..1884
Misc Feature(1)247..249
Misc Feature(2)340..402
Misc Feature(3)340..402
Misc Feature(4)349..1806
Misc Feature(5)601..1764
Misc Feature(6)604..666
Misc Feature(7)order(610..612,619..624,631..633,643..648,652..657,
Misc Feature(8)691..753
Misc Feature(9)784..846
Misc Feature(10)871..933
Misc Feature(11)961..1023
Misc Feature(12)1219..1281
Misc Feature(13)1324..1386
Misc Feature(14)1414..1476
Misc Feature(15)1510..1572
Misc Feature(16)1609..1671
Misc Feature(17)1693..1755
Misc Feature(18)1780..1782
Misc Feature(19)1816..1818
Misc Feature(20)1822..1824
Exon (1)1..324
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (2)325..417
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (3)418..680
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (4)681..805
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (5)806..921
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (6)922..1084
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (7)1085..1272
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (8)1273..1377
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (9)1378..1479
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (10)1480..1683
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (11)1684..3439
Gene:SLC2A2
Gene Synonym:GLUT2
Translation MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYV INSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGD TLGRIKAMLVANILSLVGALLMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIA PTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLGLSGVRAILQSLLLFFCP ESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSY RQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNMVFTAVSVFLV EKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPW FMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFT FFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(127)-dbSNP:
complement(127)-g, adbSNP:187648886
complement(128)-t, cdbSNP:367997215
complement(154)-t, cdbSNP:183707596
complement(262)-t, cdbSNP:372965718
complement(319)-g, cdbSNP:200073044
complement(329)-dbSNP:
complement(329)-t, gdbSNP:369700669
complement(348)-g, adbSNP:375465762
complement(349)-g, cdbSNP:372441014
complement(375)-t, gdbSNP:369781481
complement(406)-t, cdbSNP:143528640
complement(443)-dbSNP:
complement(443)-t, adbSNP:149108283
complement(467)-t, cdbSNP:145210664
complement(512)-g, adbSNP:7637863
complement(525)-g, adbSNP:139231189
complement(556)-t, cdbSNP:150851401
complement(586)-t, cdbSNP:144715667
610+a, gdbSNP:1800572
complement(638)-t, cdbSNP:5400
complement(640)-g, cdbSNP:377238940
complement(698)-dbSNP:
complement(698)-g, adbSNP:367856967
complement(718)-g, cdbSNP:144125084
complement(755)-g, cdbSNP:372621339
complement(766)-g, adbSNP:376064965
complement(770)-t, adbSNP:192720796
complement(804)-t, cdbSNP:5401
complement(838)-dbSNP:
complement(838)-t, cdbSNP:144822218
complement(856)-t, cdbSNP:368626129
complement(868)-t, cdbSNP:200213178
complement(897)-g, adbSNP:374624284
898+a, gdbSNP:121909741
complement(902)-t, g, adbSNP:149460434
903+a, gdbSNP:5404
970+dbSNP:
970+c, tdbSNP:5405
complement(1038)-g, adbSNP:200815600
1089+dbSNP:
1089+a, cdbSNP:76026576
complement(1110)-g, adbSNP:199573489
complement(1123)-c, adbSNP:140285191
complement(1131)-g, adbSNP:375047825
complement(1161)-t, cdbSNP:371899639
complement(1167)-t, cdbSNP:138709283
1168+c, tdbSNP:121909746
complement(1191)-t, gdbSNP:200467142
complement(1199)-t, cdbSNP:368432491
1201+a, gdbSNP:182778895
1210+c, tdbSNP:121909743
complement(1211)-t, cdbSNP:374492763
complement(1212)-t, cdbSNP:371010089
complement(1268)-t, cdbSNP:369101584
complement(1272)-t, gdbSNP:376134439
complement(1305)-dbSNP:
complement(1305)-t, cdbSNP:144757130
complement(1372)-t, cdbSNP:140815551
complement(1384)-dbSNP:
complement(1384)-t, gdbSNP:372845210
1386+c, tdbSNP:5408
complement(1396)-c, adbSNP:76362149
complement(1401..1402)-, gdbSNP:34066960
1402+c, tdbSNP:121909742
complement(1431)-g, adbSNP:113255143
complement(1473)-t, cdbSNP:140794946
1475+c, tdbSNP:121909747
complement(1514)-g, adbSNP:374702599
complement(1520)-t, cdbSNP:2229608
complement(1520)-t, cdbSNP:386561741
complement(1534)-t, adbSNP:140791627
1559+c, tdbSNP:121909744
complement(1560)-t, cdbSNP:371657103
1568+a, gdbSNP:121909745
1577+a, tdbSNP:28928874
complement(1578)-c, adbSNP:191885528
complement(1603)-g, adbSNP:367980651
complement(1604)-t, cdbSNP:75144723
complement(1671)-g, adbSNP:201893964
complement(1711)-dbSNP:
complement(1711)-g, cdbSNP:140138702
complement(1721)-g, cdbSNP:374342938
complement(1741)-g, cdbSNP:5397
1746+c, tdbSNP:5398
complement(1798)-t, cdbSNP:201797691
complement(1799)-t, gdbSNP:200160167
1815+a, gdbSNP:5399
complement(1833)-g, cdbSNP:374630641
complement(1859)-t, adbSNP:141574520
complement(1865)-t, cdbSNP:147959014
complement(2118)-t, gdbSNP:79424762
complement(2135..2136)-, gdbSNP:35273940
complement(2209)-t, adbSNP:189555280
complement(2240)-t, adbSNP:7610064
complement(2293)-g, adbSNP:144586128
complement(2358)-t, cdbSNP:114710971
complement(2360)-g, adbSNP:75975646
complement(2439..2440)-, cdbSNP:35577271
complement(2609)-g, cdbSNP:79770697
complement(2680)-g, adbSNP:140738490
complement(2781)-c, adbSNP:12330351
complement(2793)-g, adbSNP:77733690
complement(2804)-t, gdbSNP:56204521
complement(2811..2815)-, tacttdbSNP:372577789
complement(2814..2818)-, ctttadbSNP:140350942
complement(2943)-, adbSNP:139372968
complement(2970)-t, cdbSNP:185726034
complement(3016)-t, gdbSNP:55669541
complement(3091)-t, cdbSNP:28579899
complement(3106)-t, adbSNP:55989805
complement(3112)-g, adbSNP:181123140
complement(3141)-g, adbSNP:55679742
complement(3229)-g, cdbSNP:188353805
complement(3233)-g, adbSNP:112957674
complement(3304)-g, adbSNP:182503337
Gene SymbolSLC2A2
Gene SynonymGLUT2
Chromosome3
Locus Map3q26.1-q26.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001278659 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 2 (SLC2A2), transcript variant 3, mRNA. On-demand $549.00 14
NM_000340 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 2 (SLC2A2), transcript variant 1, mRNA. In-stock $509.00 $460.00 12
NM_001278658 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 2 (SLC2A2), transcript variant 2, mRNA. On-demand $549.00 14
Title Mutations in SLC2A2 gene reveal hGLUT2 function in pancreatic beta cell development .
Author Michau A, Guillemain G, Grosfeld A, Vuillaumier-Barrot S, Grand T, Keck M, L'Hoste S, Chateau D, Serradas P, Teulon J, De Lonlay P, Scharfmann R, Brot-Laroche E, Leturque A and Le Gall M.
Journal J. Biol. Chem. 288 (43), 31080-31092 (2013)
Title Intestinal dehydroascorbic acid (DHA) transport mediated by the facilitative sugar transporters, GLUT2 and GLUT8 .
Author Corpe CP, Eck P, Wang J, Al-Hasani H and Levine M.
Journal J. Biol. Chem. 288 (13), 9092-9101 (2013)
Title Impact of genetic polymorphisms of SLC2A2, SLC2A5, and KHK on metabolic phenotypes in hypertensive individuals .
Author Le MT, Lobmeyer MT, Campbell M, Cheng J, Wang Z, Turner ST, Chapman AB, Boerwinkle E, Gums JG, Gong Y, Johnson RJ and Johnson JA.
Journal PLoS ONE 8 (1), E52062 (2013)
Title Association of GLUT2 and TAS1R2 genotypes with risk for dental caries .
Author Kulkarni GV, Chng T, Eny KM, Nielsen D, Wessman C and El-Sohemy A.
Journal Caries Res. 47 (3), 219-225 (2013)
Title Genetic variant SLC2A2 [corrected] Is associated with risk of cardiovascular disease - assessing the individual and cumulative effect of 46 type 2 diabetes related genetic variants .
Author Borglykke A, Grarup N, Sparso T, Linneberg A, Fenger M, Jeppesen J, Hansen T, Pedersen O and Jorgensen T.
Journal PLoS ONE 7 (11), E50418 (2012)
Title Hepatocyte nuclear factor-1alpha recruits the transcriptional co-activator p300 on the GLUT2 gene promoter .
Author Ban N, Yamada Y, Someya Y, Miyawaki K, Ihara Y, Hosokawa M, Toyokuni S, Tsuda K and Seino Y.
Journal Diabetes 51 (5), 1409-1418 (2002)
Title Human and rat beta cells differ in glucose transporter but not in glucokinase gene expression .
Author De Vos A, Heimberg H, Quartier E, Huypens P, Bouwens L, Pipeleers D and Schuit F.
Journal J. Clin. Invest. 96 (5), 2489-2495 (1995)
Title Dinucleotide repeat polymorphism at the human GLUT2 locus .
Author Patel P, Lo YM, Bell GI, Turner RC and Wainscoat JS.
Journal Nucleic Acids Res. 19 (14), 4017 (1991)
Title CA repeat polymorphism in the glucose transporter GLUT 2 gene .
Author Froguel P, Zouali H, Sun F, Velho G, Fukumoto H, Passa P and Cohen D.
Journal Nucleic Acids Res. 19 (13), 3754 (1991)
Title Sequence, tissue distribution, and chromosomal localization of mRNA encoding a human glucose transporter-like protein .
Author Fukumoto H, Seino S, Imura H, Seino Y, Eddy RL, Fukushima Y, Byers MG, Shows TB and Bell GI.
Journal Proc. Natl. Acad. Sci. U.S.A. 85 (15), 5434-5438 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.