• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 2 (SLC2A2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000340 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 2 (SLC2A2), mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_000340.1, 4557850
Length 3439 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 2 (SLC2A2), mRNA.
Product solute carrier family 2, facilitated glucose transporter member 2
Comment

Summary: Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor. [provided by RefSeq, Jul 2008].

RefSeq NP_000331.1
CDS 310..1884
Misc Feature(1)247..249
Misc Feature(2)340..402
Misc Feature(3)340..402
Misc Feature(4)349..1806
Misc Feature(5)601..>1029
Misc Feature(6)604..666
Misc Feature(7)691..753
Misc Feature(8)784..846
Misc Feature(9)871..933
Misc Feature(10)961..1023
Misc Feature(11)<1216..1698
Misc Feature(12)1219..1281
Misc Feature(13)1324..1386
Misc Feature(14)1414..1476
Misc Feature(15)1510..1572
Misc Feature(16)1609..1671
Misc Feature(17)1693..1755
Misc Feature(18)1780..1782
Misc Feature(19)1816..1818
Misc Feature(20)1822..1824
Exon (1)1..324
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (2)325..417
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (3)418..680
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (4)681..805
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (5)806..921
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (6)922..1084
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (7)1085..1272
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (8)1273..1377
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (9)1378..1479
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (10)1480..1683
Gene:SLC2A2
Gene Synonym:GLUT2
Exon (11)1684..3439
Gene:SLC2A2
Gene Synonym:GLUT2
Translation MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYV INSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGD TLGRIKAMLVANILSLVGALLMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIA PTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLGLSGVRAILQSLLLFFCP ESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSY RQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNMVFTAVSVFLV EKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPW FMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFT FFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(127)-dbSNP:
complement(127)-g, adbSNP:187648886
complement(154)-t, cdbSNP:183707596
complement(319)-g, cdbSNP:200073044
complement(406)-dbSNP:
complement(406)-t, cdbSNP:143528640
complement(443)-dbSNP:
complement(443)-t, adbSNP:149108283
complement(467)-t, cdbSNP:145210664
complement(512)-g, adbSNP:7637863
complement(525)-g, adbSNP:139231189
complement(556)-t, cdbSNP:150851401
complement(586)-t, cdbSNP:144715667
complement(610)-g, adbSNP:1800572
complement(638)-t, cdbSNP:5400
complement(718)-dbSNP:
complement(718)-g, cdbSNP:144125084
complement(734)-t, adbSNP:148172510
complement(770)-t, adbSNP:192720796
complement(804)-t, cdbSNP:5401
complement(838)-dbSNP:
complement(838)-t, cdbSNP:144822218
complement(868)-t, cdbSNP:200213178
complement(898)-g, adbSNP:121909741
complement(902)-t, g, adbSNP:149460434
complement(903)-g, adbSNP:5404
complement(970)-dbSNP:
complement(970)-t, cdbSNP:5405
complement(1038)-g, adbSNP:200815600
complement(1089)-dbSNP:
complement(1089)-c, adbSNP:76026576
complement(1110)-g, adbSNP:199573489
complement(1123)-c, adbSNP:140285191
complement(1167)-t, cdbSNP:138709283
complement(1168)-t, cdbSNP:121909746
complement(1191)-t, gdbSNP:200467142
complement(1201)-g, adbSNP:182778895
complement(1210)-t, cdbSNP:121909743
complement(1305)-dbSNP:
complement(1305)-t, cdbSNP:144757130
complement(1372)-t, cdbSNP:140815551
complement(1376)-g, cdbSNP:151012106
complement(1377)-c, adbSNP:142643844
complement(1386)-dbSNP:
complement(1386)-t, cdbSNP:5408
complement(1396)-c, adbSNP:76362149
complement(1401..1402)-, gdbSNP:34066960
complement(1402)-t, cdbSNP:121909742
complement(1431)-g, adbSNP:113255143
complement(1473)-t, cdbSNP:140794946
complement(1475)-t, cdbSNP:121909747
complement(1520)-t, cdbSNP:2229608
complement(1534)-t, adbSNP:140791627
complement(1559)-t, cdbSNP:121909744
complement(1568)-g, adbSNP:121909745
complement(1577)-t, adbSNP:28928874
complement(1578)-c, adbSNP:191885528
complement(1604)-t, cdbSNP:75144723
complement(1671)-g, adbSNP:201893964
complement(1711)-dbSNP:
complement(1711)-g, cdbSNP:140138702
complement(1741)-g, cdbSNP:5397
complement(1746)-t, cdbSNP:5398
complement(1798)-t, cdbSNP:201797691
complement(1799)-t, gdbSNP:200160167
complement(1815)-g, adbSNP:5399
complement(1859)-t, adbSNP:141574520
complement(1860)-g, adbSNP:148414372
complement(1865)-t, cdbSNP:147959014
complement(2118)-t, gdbSNP:79424762
complement(2136..2137)-, gdbSNP:35273940
complement(2209)-t, adbSNP:189555280
complement(2240)-t, adbSNP:7610064
complement(2293)-g, adbSNP:144586128
complement(2358)-t, cdbSNP:114710971
complement(2360)-g, adbSNP:75975646
complement(2440..2441)-, cdbSNP:35577271
complement(2609)-g, cdbSNP:79770697
complement(2680)-g, adbSNP:140738490
complement(2781)-c, adbSNP:12330351
complement(2793)-g, adbSNP:77733690
complement(2804)-t, gdbSNP:56204521
complement(2814..2818)-, ctttadbSNP:140350942
complement(2943)-, adbSNP:139372968
complement(2970)-t, cdbSNP:185726034
complement(3016)-t, gdbSNP:55669541
complement(3091)-t, cdbSNP:28579899
complement(3106)-t, adbSNP:55989805
complement(3112)-g, adbSNP:181123140
complement(3141)-g, adbSNP:55679742
complement(3229)-g, cdbSNP:188353805
complement(3233)-g, adbSNP:112957674
complement(3304)-g, adbSNP:182503337
Gene SymbolSLC2A2
Gene SynonymGLUT2
Chromosome3
Locus Map3q26.1-q26.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000340 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 2 (SLC2A2), mRNA. In-stock $509.00 $460.00 12
Title Hepatitis C virus infection suppresses GLUT2 gene expression via downregulation of hepatocyte nuclear factor 1alpha .
Author Matsui,C., Shoji,I., Kaneda,S., Sianipar,I.R., Deng,L. and Hotta,H.
Journal J. Virol. 86 (23), 12903-12911 (2012)
Title Fanconi-Bickel syndrome and autosomal recessive proximal tubulopathy with hypercalciuria (ARPTH) are allelic variants caused by GLUT2 mutations .
Author Mannstadt,M., Magen,D., Segawa,H., Stanley,T., Sharma,A., Sasaki,S., Bergwitz,C., Mounien,L., Boepple,P., Thorens,B., Zelikovic,I. and Juppner,H.
Journal J. Clin. Endocrinol. Metab. 97 (10), E1978-E1986 (2012)
Title SLC2A2 mutations can cause neonatal diabetes, suggesting GLUT2 may have a role in human insulin secretion .
Author Sansbury,F.H., Flanagan,S.E., Houghton,J.A., Shuixian Shen,F.L., Al-Senani,A.M., Habeb,A.M., Abdullah,M., Kariminejad,A., Ellard,S. and Hattersley,A.T.
Journal Diabetologia 55 (9), 2381-2385 (2012)
Title A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance .
Author Manning,A.K., Hivert,M.F., Scott,R.A., Grimsby,J.L., Bouatia-Naji,N., Chen,H., Rybin,D., Liu,C.T., Bielak,L.F., Prokopenko,I., Amin,N., Barnes,D., Cadby,G., Hottenga,J.J., Ingelsson,E., Jackson,A.U., Johnson,T., Kanoni,S., Ladenvall,C., Lagou,V., Lahti,J., Lecoeur,C., Liu,Y., Martinez-Larrad,M.T., Montasser,M.E., Navarro,P., Perry,J.R., Rasmussen-Torvik,L.J., Salo,P., Sattar,N., Shungin,D., Strawbridge,R.J., Tanaka,T., van Duijn,C.M., An,P., de Andrade,M., Andrews,J.S., Aspelund,T., Atalay,M., Aulchenko,Y., Balkau,B., Bandinelli,S., Beckmann,J.S., Beilby,J.P., Bellis,C., Bergman,R.N., Blangero,J., Boban,M., Boehnke,M., Boerwinkle,E., Bonnycastle,L.L., Boomsma,D.I., Borecki,I.B., Bottcher,Y., Bouchard,C., Brunner,E., Budimir,D., Campbell,H., Carlson,O., Chines,P.S., Clarke,R., Collins,F.S., Corbaton-Anchuelo,A., Couper,D., de Faire,U., Dedoussis,G.V., Deloukas,P., Dimitriou,M., Egan,J.M., Eiriksdottir,G., Erdos,M.R., Eriksson,J.G., Eury,E., Ferrucci,L., Ford,I., Forouhi,N.G., Fox,C.S., Franzosi,M.G., Franks,P.W., Frayling,T.M., Froguel,P., Galan,P., de Geus,E., Gigante,B., Glazer,N.L., Goel,A., Groop,L., Gudnason,V., Hallmans,G., Hamsten,A., Hansson,O., Harris,T.B., Hayward,C., Heath,S., Hercberg,S., Hicks,A.A., Hingorani,A., Hofman,A., Hui,J., Hung,J., Jarvelin,M.R., Jhun,M.A., Johnson,P.C., Jukema,J.W., Jula,A., Kao,W.H., Kaprio,J., Kardia,S.L., Keinanen-Kiukaanniemi,S., Kivimaki,M., Kolcic,I., Kovacs,P., Kumari,M., Kuusisto,J., Kyvik,K.O., Laakso,M., Lakka,T., Lannfelt,L., Lathrop,G.M., Launer,L.J., Leander,K., Li,G., Lind,L., Lindstrom,J., Lobbens,S., Loos,R.J., Luan,J., Lyssenko,V., Magi,R., Magnusson,P.K., Marmot,M., Meneton,P., Mohlke,K.L., Mooser,V., Morken,M.A., Miljkovic,I., Narisu,N., O'Connell,J., Ong,K.K., Oostra,B.A., Palmer,L.J., Palotie,A., Pankow,J.S., Peden,J.F., Pedersen,N.L., Pehlic,M., Peltonen,L., Penninx,B., Pericic,M., Perola,M., Perusse,L., Peyser,P.A., Polasek,O., Pramstaller,P.P., Province,M.A., Raikkonen,K., Rauramaa,R., Rehnberg,E., Rice,K., Rotter,J.I., Rudan,I., Ruokonen,A., Saaristo,T., Sabater-Lleal,M., Salomaa,V., Savage,D.B., Saxena,R., Schwarz,P., Seedorf,U., Sennblad,B., Serrano-Rios,M., Shuldiner,A.R., Sijbrands,E.J., Siscovick,D.S., Smit,J.H., Small,K.S., Smith,N.L., Smith,A.V., Stancakova,A., Stirrups,K., Stumvoll,M., Sun,Y.V., Swift,A.J., Tonjes,A., Tuomilehto,J., Trompet,S., Uitterlinden,A.G., Uusitupa,M., Vikstrom,M., Vitart,V., Vohl,M.C., Voight,B.F., Vollenweider,P., Waeber,G., Waterworth,D.M., Watkins,H., Wheeler,E., Widen,E., Wild,S.H., Willems,S.M., Willemsen,G., Wilson,J.F., Witteman,J.C., Wright,A.F., Yaghootkar,H., Zelenika,D., Zemunik,T., Zgaga,L., Wareham,N.J., McCarthy,M.I., Barroso,I., Watanabe,R.M., Florez,J.C., Dupuis,J., Meigs,J.B. and Langenberg,C.
Journal Nat. Genet. 44 (6), 659-669 (2012)
Title Genome-wide significant association between a 'negative mood delusions' dimension in bipolar disorder and genetic variation on chromosome 3q26.1 .
Author Meier,S., Mattheisen,M., Vassos,E., Strohmaier,J., Treutlein,J., Josef,F., Breuer,R., Degenhardt,F., Muhleisen,T.W., Muller-Myhsok,B., Steffens,M., Schmael,C., McMahon,F.J., Nothen,M.M., Cichon,S., Schulze,T.G., Rietschel,M., Kelsoe,J.R., Greenwood,T.A., Nievergelt,C.M., Barrett,T.B., McKinney,R., Shilling,P.D., Schork,N.J., Smith,E.N., Bloss,C.S., Nurnberger,J., Edenberg,H.J., Foroud,T., Koller,D.L., Gershon,E.S., Liu,C.Y., Badner,J.A., Scheftner,W., Lawson,W.B., Nwulia,E.A., Hipolito,M., Coryell,W., Rice,J., Byerley,W., McMahon,F., Chen,D.T., Schulze,T.G., Berrettini,W., Potash,J.B., Zandi,P.P., Mahon,P.B., McInnis,M., Craig,D. and Szelinger,S.
Journal Transl Psychiatry 2, E165 (2012)
Title Human and rat beta cells differ in glucose transporter but not in glucokinase gene expression .
Author De Vos,A., Heimberg,H., Quartier,E., Huypens,P., Bouwens,L., Pipeleers,D. and Schuit,F.
Journal J. Clin. Invest. 96 (5), 2489-2495 (1995)
Title A mutation in the Glut2 glucose transporter gene of a diabetic patient abolishes transport activity .
Author Mueckler,M., Kruse,M., Strube,M., Riggs,A.C., Chiu,K.C. and Permutt,M.A.
Journal J. Biol. Chem. 269 (27), 17765-17767 (1994)
Title Dinucleotide repeat polymorphism at the human GLUT2 locus .
Author Patel,P., Lo,Y.M., Bell,G.I., Turner,R.C. and Wainscoat,J.S.
Journal Nucleic Acids Res. 19 (14), 4017 (1991)
Title CA repeat polymorphism in the glucose transporter GLUT 2 gene .
Author Froguel,P., Zouali,H., Sun,F., Velho,G., Fukumoto,H., Passa,P. and Cohen,D.
Journal Nucleic Acids Res. 19 (13), 3754 (1991)
Title Sequence, tissue distribution, and chromosomal localization of mRNA encoding a human glucose transporter-like protein .
Author Fukumoto,H., Seino,S., Imura,H., Seino,Y., Eddy,R.L., Fukushima,Y., Byers,M.G., Shows,T.B. and Bell,G.I.
Journal Proc. Natl. Acad. Sci. U.S.A. 85 (15), 5434-5438 (1988)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.