• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 8 (ABCC8), mRNA.


RefSeq Accession Definition Services Price Order
NM_000352 Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 8 (ABCC8), mRNA. ORF Sequence $1661.10
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000352.3, 118582254
Length 4980 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 8 (ABCC8), mRNA.
Product ATP-binding cassette sub-family C member 8
Comment

Summary: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternative splicing of this gene has been observed; however, the transcript variants have not been fully described. [provided by RefSeq, Jul 2008].

RefSeq NP_000343.2
CDS 127..4872
Misc Feature(1)229..291
Misc Feature(2)229..291
Misc Feature(3)352..414
Misc Feature(4)430..492
Misc Feature(5)529..588
Misc Feature(6)628..708
Misc Feature(7)985..2922
Misc Feature(8)1060..1119
Misc Feature(9)1078..1896
Misc Feature(10)1192..1254
Misc Feature(11)1429..1491
Misc Feature(12)1501..1563
Misc Feature(13)1750..1812
Misc Feature(14)1879..1941
Misc Feature(15)2161..2844
Misc Feature(16)2263..2286
Misc Feature(17)order(2272..2277,2281..2289,2446..2448,2683..2688,
Misc Feature(18)2437..2448
Misc Feature(19)2611..2640
Misc Feature(20)2671..2688
Misc Feature(21)2695..2706
Misc Feature(22)2776..2796
Misc Feature(23)3139..3201
Misc Feature(24)3295..4008
Misc Feature(25)3331..4833
Misc Feature(26)3343..3405
Misc Feature(27)3538..3600
Misc Feature(28)3604..3666
Misc Feature(29)3880..3942
Misc Feature(30)3955..4017
Misc Feature(31)4150..4869
Misc Feature(32)4258..4281
Misc Feature(33)order(4267..4272,4276..4284,4402..4404,4639..4644,
Misc Feature(34)4393..4404
Misc Feature(35)4567..4596
Misc Feature(36)4627..4644
Misc Feature(37)4651..4662
Misc Feature(38)4732..4752
Exon (1)1..274
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (2)275..416
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (3)417..538
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (4)539..705
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (5)706..948
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (6)949..1137
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (7)1138..1302
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (8)1303..1458
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (9)1459..1593
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (10)1594..1756
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (11)1757..1797
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (12)1798..1943
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (13)1944..2049
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (14)2050..2166
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (15)2167..2242
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (16)2243..2348
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (17)2349..2381
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (18)2382..2417
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (19)2418..2516
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (20)2517..2601
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (21)2602..2682
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (22)2683..2820
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (23)2821..2946
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (24)2947..3046
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (25)3047..3288
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (26)3289..3455
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (27)3456..3525
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (28)3526..3683
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (29)3684..3776
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (30)3777..3879
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (31)3880..3993
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (32)3994..4114
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (33)4115..4245
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (34)4246..4324
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (35)4325..4433
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (36)4434..4537
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (37)4538..4671
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (38)4672..4734
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Exon (39)4735..4978
Gene:ABCC8
Gene Synonym:ABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Translation MPLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHI HHSTWLHFPGHNLRWILTFMLLFVLVCEIAEGILSDGVTESHHLHLYMPAGMAFMAAVTS VVYYHNIETSNFPKLLIALLVYWTLAFITKTIKFVKFLDHAIGFSQLRFCLTGLLVILYG MLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA HKKPIDLRAIGKLPIAMRALTNYQRLCEAFDAQVRKDIQGTQGARAIWQALSHAFGRRLV LSSTFRILADLLGFAGPLCIFGIVDHLGKENDVFQPKTQFLGVYFVSSQEFLANAYVLAV LLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIMHLSTSNLSMGEMTAGQICNL VAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK LSQAQRSTLEYSNERLKQTNEMLRGIKLLKLYAWENIFRTRVETTRRKEMTSLRAFAIYT SISIFMNTAIPIAAVLITFVGHVSFFKEADFSPSVAFASLSLFHILVTPLFLLSSVVRST VKALVSVQKLSEFLSSAEIREEQCAPHEPTPQGPASKYQAVPLRVVNRKRPAREDCRGLT GPLQSLVPSADGDADNCCVQIMGGYFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS SLLLAALGEMQKVSGAVFWSSLPDSEIGEDPSPERETATDLDIRKRGPVAYASQKPWLLN ATVEENIIFESPFNKQRYKMVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVA RALYQHANVVFLDDPFSALDIHLSDHLMQAGILELLRDDKRTVVLVTHKLQYLPHADWII AMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKATEPPQGLSRAMS SRDGLLQDEEEEEEEAAESEEDDNLSSMLHQRAEIPWRACAKYLSSAGILLLSLLVFSQL LKHMVLVAIDYWLAKWTDSALTLTPAARNCSLSQECTLDQTVYAMVFTVLCSLGIVLCLV TSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGSILNRFSSDCNTIDQHIPSTLE CLSRSTLLCVSALAVISYVTPVFLVALLPLAIVCYFIQKYFRVASRDLQQLDDTTQLPLL SHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVRMEYIGACVVL IAAVTSISNSLHRELSAGLVGLGLTYALMVSNYLNWMVRNLADMELQLGAVKRIHGLLKT EAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKPVLKHVNALIAPGQKIGICGRT GSGKSSFSLAFFRMVDTFEGHIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNLD PERKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTS IFIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVHTILSADLVIVLKRGAILEFD KPEKLLSRKDSVFASFVRADK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(39)-dbSNP:
complement(39)-t, gdbSNP:72559430
complement(69)-t, adbSNP:72559429
complement(74..75)-, tggctccgcdbSNP:78092663
complement(78)-g, cdbSNP:77498130
complement(108)-g, adbSNP:193922394
complement(119)-c, adbSNP:200091822
complement(120)-g, adbSNP:147198610
complement(188)-t, adbSNP:200670692
complement(228)-t, cdbSNP:189746511
complement(231)-t, cdbSNP:199925058
260+c, tdbSNP:267606623
complement(333)-dbSNP:
complement(333)-t, g, c, adbSNP:1048099
complement(341)-g, adbSNP:80356634
complement(346)-g, adbSNP:201682634
complement(347)-t, cdbSNP:72559734
complement(355)-g, cdbSNP:72559733
complement(356)-c, adbSNP:72559732
complement(383)-t, g, cdbSNP:193929360
complement(424)-dbSNP:
complement(424)-t, cdbSNP:200687571
complement(436)-g, cdbSNP:10400391
complement(456)-t, cdbSNP:8192695
complement(469)-t, cdbSNP:146695489
complement(472)-g, cdbSNP:72559731
complement(478)-t, cdbSNP:144641450
complement(480)-g, adbSNP:137873871
complement(501)-g, cdbSNP:60637558
complement(518)-t, cdbSNP:76030764
complement(520)-t, g, cdbSNP:80356637
complement(530)-t, cdbSNP:193929364
complement(549)-dbSNP:
complement(549)-t, g, c, adbSNP:116132921
complement(595)-g, adbSNP:1048098
complement(612)-g, adbSNP:149872185
complement(625)-g, cdbSNP:1048096
complement(630)-g, adbSNP:139224499
complement(678)-g, adbSNP:151211613
complement(686)-t, adbSNP:137852672
complement(753)-dbSNP:
complement(753)-t, c, adbSNP:80356640
complement(755)-c, adbSNP:188669612
complement(757)-c, adbSNP:193929366
complement(764)-t, gdbSNP:80356642
complement(773)-t, cdbSNP:199702708
complement(800)-t, cdbSNP:1048095
complement(815)-t, cdbSNP:140476117
complement(849)-g, adbSNP:147276708
complement(868)-g, adbSNP:72559730
complement(893)-g, adbSNP:1048094
complement(894)-g, adbSNP:1048093
complement(930)-t, cdbSNP:187271585
complement(944)-t, cdbSNP:200497718
complement(949)-dbSNP:
complement(949)-g, adbSNP:201907204
complement(950)-t, cdbSNP:185040406
complement(980)-t, cdbSNP:199616008
complement(997)-g, adbSNP:199865744
complement(1009)-t, adbSNP:142651082
complement(1012)-t, cdbSNP:148529020
complement(1018)-g, adbSNP:144705160
complement(1052)-g, cdbSNP:149347593
complement(1060)-t, gdbSNP:72559729
complement(1071)-g, adbSNP:138521721
complement(1116)-t, cdbSNP:45522932
complement(1149)-dbSNP:
complement(1149)-g, adbSNP:199592045
complement(1189)-t, cdbSNP:145136257
complement(1193)-t, cdbSNP:59852838
complement(1270)-g, adbSNP:80356651
complement(1284)-g, adbSNP:60824529
complement(1315)-dbSNP:
complement(1315)-t, gdbSNP:199763382
complement(1338)-g, adbSNP:138386829
complement(1342)-t, cdbSNP:72559728
complement(1378)-g, adbSNP:67254669
complement(1407)-t, cdbSNP:112488640
complement(1469)-dbSNP:
complement(1469)-c, adbSNP:200528170
complement(1492)-g, cdbSNP:200257654
complement(1510)-t, cdbSNP:117874766
complement(1511)-g, adbSNP:202183744
complement(1560)-g, adbSNP:200303681
complement(1612)-dbSNP:
complement(1612)-g, adbSNP:150956385
complement(1636)-g, adbSNP:201815564
complement(1637)-t, cdbSNP:143451249
complement(1638)-g, adbSNP:148811815
complement(1639)-c, adbSNP:200977997
complement(1649)-g, adbSNP:72559727
complement(1698)-t, cdbSNP:61748766
complement(1703)-t, cdbSNP:144481621
complement(1732)-t, cdbSNP:193922396
complement(1742)-g, adbSNP:193922397
complement(1746)-g, adbSNP:199822807
complement(1804)-dbSNP:
complement(1804)-g, adbSNP:4148619
complement(1812)-t, g, c, adbSNP:1799857
complement(1833)-g, adbSNP:147623093
complement(1834)-t, cdbSNP:201123779
complement(1849)-t, cdbSNP:149930713
complement(1870)-g, cdbSNP:137852674
complement(1899)-g, cdbSNP:72559726
complement(1918)-g, adbSNP:139328569
complement(1944)-dbSNP:
complement(1944)-g, adbSNP:202207978
complement(1956)-t, cdbSNP:150839950
complement(1984)-g, adbSNP:58241708
complement(2000)-g, adbSNP:148709148
complement(2018)-, gdbSNP:72559725
complement(2046)-t, cdbSNP:146156937
complement(2052)-dbSNP:
complement(2052)-g, cdbSNP:75376282
complement(2073)-t, g, c, adbSNP:1799858
complement(2084)-t, cdbSNP:146378237
complement(2099)-t, cdbSNP:149400972
complement(2119)-t, adbSNP:199784172
complement(2123)-c, adbSNP:200670709
complement(2127)-g, cdbSNP:201425938
complement(2168)-dbSNP:
complement(2168)-g, adbSNP:137984699
complement(2186)-g, adbSNP:150316347
complement(2228..2229)-, adbSNP:72559724
complement(2230)-g, adbSNP:199732808
complement(2248)-dbSNP:
complement(2248)-g, adbSNP:201240787
complement(2273)-c, adbSNP:72559723
complement(2278)-t, cdbSNP:200286058
complement(2289)-t, cdbSNP:201724038
complement(2301)-g, adbSNP:140109097
complement(2302)-t, cdbSNP:138687850
complement(2303)-g, adbSNP:145747227
complement(2332)-c, adbSNP:191697443
complement(2361)-dbSNP:
complement(2361)-g, adbSNP:200708414
complement(2379)-g, adbSNP:142315209
complement(2403)-dbSNP:
complement(2403)-t, cdbSNP:1801261
complement(2430)-dbSNP:
complement(2430)-g, adbSNP:199541853
complement(2515)-g, adbSNP:142620721
complement(2529)-dbSNP:
complement(2529)-t, gdbSNP:148863748
complement(2548)-t, gdbSNP:202189540
complement(2560)-t, cdbSNP:146916682
complement(2574)-g, adbSNP:149628344
complement(2579)-t, cdbSNP:111228378
complement(2611)-dbSNP:
complement(2611)-t, cdbSNP:1805036
complement(2626)-g, adbSNP:140068774
complement(2632)-g, adbSNP:72559722
complement(2643)-c, adbSNP:184329953
complement(2664)-g, adbSNP:73423037
complement(2670)-g, adbSNP:144200345
complement(2736)-dbSNP:
complement(2736)-g, adbSNP:111967655
complement(2745)-c, adbSNP:146380439
complement(2817)-g, adbSNP:201609520
complement(2989)-dbSNP:
complement(2989)-g, adbSNP:200877883
complement(2993)-g, adbSNP:72559721
complement(3084)-dbSNP:
complement(3084)-t, cdbSNP:58820146
complement(3101)-t, cdbSNP:201499958
complement(3103)-t, cdbSNP:148342166
complement(3126)-g, adbSNP:192863214
complement(3127)-t, cdbSNP:144329652
complement(3144)-g, adbSNP:149279510
complement(3164)-g, cdbSNP:72559720
complement(3165)-g, adbSNP:17846762
complement(3167)-t, adbSNP:67706538
complement(3169)-t, gdbSNP:72559719
complement(3225)-t, cdbSNP:200693100
complement(3231)-t, cdbSNP:138722795
complement(3237)-g, adbSNP:201662945
complement(3243)-g, adbSNP:199723884
complement(3282)-g, adbSNP:145811577
complement(3294)-dbSNP:
complement(3294)-t, cdbSNP:1799860
complement(3329)-g, adbSNP:139524121
complement(3376)-t, cdbSNP:138204865
complement(3418)-g, adbSNP:150368331
complement(3433)-t, gdbSNP:144348011
complement(3456)-dbSNP:
complement(3456)-t, cdbSNP:140311333
complement(3471)-t, cdbSNP:186634115
complement(3539)-dbSNP:
complement(3539)-g, adbSNP:201351976
complement(3562)-t, adbSNP:56945577
complement(3612)-c, adbSNP:151203959
complement(3636)-g, cdbSNP:1048091
complement(3641)-g, adbSNP:199626046
complement(3642)-g, adbSNP:142155036
complement(3643)-t, cdbSNP:141322087
complement(3663)-t, cdbSNP:146574155
complement(3668)-t, gdbSNP:193922399
complement(3671)-g, adbSNP:193922400
complement(3677)-c, adbSNP:137852675
complement(3678)-t, cdbSNP:144207158
complement(3680)-c, adbSNP:193929369
complement(3704)-dbSNP:
complement(3704)-t, adbSNP:139486832
complement(3729)-t, cdbSNP:145874746
complement(3738)-g, adbSNP:149861153
complement(3766)-g, adbSNP:139964066
complement(3903)-dbSNP:
complement(3903)-t, cdbSNP:150679949
complement(3945)-g, adbSNP:1799859
complement(3960)-g, adbSNP:140414060
complement(3981)-g, adbSNP:56924677
complement(4014)-dbSNP:
complement(4014)-c, adbSNP:147153615
complement(4070)-t, cdbSNP:143438476
complement(4078)-g, adbSNP:111603608
complement(4086)-g, adbSNP:137868047
complement(4101)-g, adbSNP:138141427
complement(4102)-t, cdbSNP:200563930
complement(4107)-t, cdbSNP:1129799
complement(4134)-g, cdbSNP:67767715
complement(4177)-t, cdbSNP:149331388
complement(4181)-g, c, adbSNP:28936370
complement(4216)-t, cdbSNP:138642224
complement(4218)-g, adbSNP:150151029
complement(4231)-t, gdbSNP:757110
complement(4248)-dbSNP:
complement(4248)-g, adbSNP:75218493
complement(4261)-t, c, adbSNP:137852673
complement(4262)-t, gdbSNP:193922401
complement(4283)-g, adbSNP:72559718
complement(4285..4287)-, ttcdbSNP:151344624
complement(4324)-g, adbSNP:137852676
complement(4353)-dbSNP:
complement(4353)-g, adbSNP:146584228
complement(4384)-t, cdbSNP:28938469
complement(4396)-g, adbSNP:80356653
complement(4432)-t, cdbSNP:193922402
complement(4494)-dbSNP:
complement(4494)-g, cdbSNP:193922403
complement(4495)-t, cdbSNP:72559717
complement(4537)-t, cdbSNP:72559716
complement(4557)-dbSNP:
complement(4557)-g, adbSNP:145673861
complement(4558)-t, cdbSNP:72559715
complement(4577)-g, adbSNP:193922405
complement(4600)-t, cdbSNP:72559714
complement(4603)-t, cdbSNP:28936371
complement(4622)-g, cdbSNP:140599332
complement(4642)-g, adbSNP:137852671
complement(4648)-t, gdbSNP:80075294
complement(4668)-t, gdbSNP:113282901
complement(4679)-dbSNP:
complement(4679)-t, gdbSNP:193922406
complement(4689)-c, adbSNP:142272833
complement(4690)-g, adbSNP:193922407
complement(4714)-g, adbSNP:148808854
complement(4741)-dbSNP:
complement(4741)-g, adbSNP:193922408
complement(4754)-g, adbSNP:72559713
complement(4779)-g, adbSNP:17846721
complement(4782)-t, cdbSNP:145386421
complement(4833)-t, cdbSNP:192371917
complement(4834)-g, cdbSNP:200934986
complement(4840)-g, adbSNP:8192690
complement(4846)-t, cdbSNP:199736860
complement(4851)-g, adbSNP:200402268
complement(4854)-g, adbSNP:73419228
complement(4858)-g, adbSNP:147170162
complement(4859)-t, cdbSNP:143557848
complement(4919)-g, adbSNP:201109109
Gene SymbolABCC8
Gene SynonymABC36; HHF1; HI; HRINS; MRP8; PHHI; SUR; SUR1; SUR1delta2; TNDM2
Chromosome11
Locus Map11p15.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000352 Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 8 (ABCC8), mRNA. Full Length $1743.00
ORF Sequence $1661.10
Title Next-generation sequencing reveals deep intronic cryptic ABCC8 and .
Author Flanagan,S.E., Xie,W., Caswell,R., Damhuis,A., Vianey-Saban,C., Akcay,T., Darendeliler,F., Bas,F., Guven,A., Siklar,Z., Ocal,G., Berberoglu,M., Murphy,N., O'Sullivan,M., Green,A., Clayton,P.E., Banerjee,I., Clayton,P.T., Hussain,K., Weedon,M.N. and Ellard,S.
Journal Am. J. Hum. Genet. 92 (1), 131-136 (2013)
Title Prolonged exposure to methylglyoxal causes disruption of vascular .
Author Yang,Y., Li,S., Konduru,A.S., Zhang,S., Trower,T.C., Shi,W., Cui,N., Yu,L., Wang,Y., Zhu,D. and Jiang,C.
Journal Am. J. Physiol., Cell Physiol. 303 (10), C1045-C1054 (2012)
Title Three cases of permanent neonatal diabetes mellitus: genotypes and management outcome .
Author Ooi,H.L. and Wu,L.L.
Journal Singapore Med J 53 (7), E142-E144 (2012)
Title Effects of single nucleotide polymorphisms in K(ATP) channel genes on type 2 diabetes in a Turkish population .
Author Gonen,M.S., Arikoglu,H., Erkoc Kaya,D., Ozdemir,H., Ipekci,S.H., Arslan,A., Kayis,S.A. and Gogebakan,B.
Journal Arch. Med. Res. 43 (4), 317-323 (2012)
Title The common C49620T polymorphism in the sulfonylurea receptor gene SUR1 (ABCC8) in patients with gestational diabetes and subsequent glucose metabolism abnormalities .
Author Moleda,P., Binczak-Kuleta,A., Homa,K., Safranow,K., Celewicz,Z., Syrenicz,A., Stefanski,A., Fronczyk,A. and Majkowska,L.
Journal Exp Diabetes Res 2012, 712617 (2012)
Title ABCC8 and ABCC9: ABC transporters that regulate K+ channels .
Author Bryan,J., Munoz,A., Zhang,X., Dufer,M., Drews,G., Krippeit-Drews,P. and Aguilar-Bryan,L.
Journal Pflugers Arch. 453 (5), 703-718 (2007)
Title Reconstitution of IKATP: an inward rectifier subunit plus the sulfonylurea receptor .
Author Inagaki,N., Gonoi,T., Clement,J.P. IV, Namba,N., Inazawa,J., Gonzalez,G., Aguilar-Bryan,L., Seino,S. and Bryan,J.
Journal Science 270 (5239), 1166-1170 (1995)
Title Mutations in the sulfonylurea receptor gene in familial persistent hyperinsulinemic hypoglycemia of infancy .
Author Thomas,P.M., Cote,G.J., Wohllk,N., Haddad,B., Mathew,P.M., Rabl,W., Aguilar-Bryan,L., Gagel,R.F. and Bryan,J.
Journal Science 268 (5209), 426-429 (1995)
Title Cloning of the beta cell high-affinity sulfonylurea receptor: a regulator of insulin secretion .
Author Aguilar-Bryan,L., Nichols,C.G., Wechsler,S.W., Clement,J.P. IV, Boyd,A.E. III, Gonzalez,G., Herrera-Sosa,H., Nguy,K., Bryan,J. and Nelson,D.A.
Journal Science 268 (5209), 423-426 (1995)
Title Homozygosity mapping, to chromosome 11p, of the gene for familial persistent hyperinsulinemic hypoglycemia of infancy .
Author Thomas,P.M., Cote,G.J., Hallman,D.M. and Mathew,P.M.
Journal Am. J. Hum. Genet. 56 (2), 416-421 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878