• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transglutaminase 1 (TGM1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000359 Homo sapiens transglutaminase 1 (TGM1), mRNA. GenEZ ORF Cloning In-stock $809.00 $760.00 15

*Business Day

Related Services

RefSeq Version NM_000359.2, 110611244
Length 2777 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens transglutaminase 1 (TGM1), mRNA.
Product protein-glutamine gamma-glutamyltransferase K
Comment

Summary: The protein encoded by this gene is a membrane protein that catalyzes the addition of an alkyl group from an akylamine to a glutamine residue of a protein, forming an alkylglutamine in the protein. This protein alkylation leads to crosslinking of proteins and catenation of polyamines to proteins. This gene contains either one or two copies of a 22 nt repeat unit in its 3' UTR. Mutations in this gene have been associated with autosomal recessive lamellar ichthyosis (LI) and nonbullous congenital ichthyosiform erythroderma (NCIE). [provided by RefSeq, Jul 2008].

RefSeq NP_000350.1
CDS 125..2578
Misc Feature(1)65..67
Misc Feature(2)125..424
Misc Feature(3)125..424
Misc Feature(4)194..196
Misc Feature(5)368..370
Misc Feature(6)377..379
Misc Feature(7)398..400
Misc Feature(8)452..811
Misc Feature(9)1235..1510
Misc Feature(10)1859..2173
Misc Feature(11)2195..2488
Exon (1)1..122
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (2)123..443
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (3)444..632
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (4)633..881
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (5)882..1000
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (6)1001..1108
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (7)1109..1283
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (8)1284..1422
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (9)1423..1526
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (10)1527..1615
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (11)1616..1769
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (12)1770..2051
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (13)2052..2212
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (14)2213..2349
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Exon (15)2350..2777
Gene:TGM1
Gene Synonym:ARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Translation MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDD WGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAAGDGTIREGMLVVNGVDLLSS RSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTH VIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPR NEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDA CLYILDRRGMPYGGRGDPVNVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVE ILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDEN MKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESI KNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDI TYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVML INHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLV DQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVT LTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHG VIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(4)-dbSNP:
complement(4)-t, gdbSNP:41295328
complement(30)-g, adbSNP:144764474
complement(83)-g, adbSNP:8003142
98+c, tdbSNP:2748512
complement(101)-g, adbSNP:147260129
complement(140)-g, adbSNP:372412279
complement(141)-t, cdbSNP:368781510
complement(145)-g, adbSNP:150913268
complement(146)-g, cdbSNP:376706308
complement(150)-c, adbSNP:267603965
complement(178)-g, adbSNP:41295336
complement(184)-g, adbSNP:145812304
complement(185)-t, cdbSNP:140542428
complement(189)-g, adbSNP:201774398
complement(210)-g, adbSNP:200873762
complement(220)-g, adbSNP:151333205
complement(221)-t, cdbSNP:142455594
complement(224)-g, adbSNP:149148326
complement(226)-g, cdbSNP:374708302
complement(230)-t, gdbSNP:145197904
complement(231)-t, cdbSNP:367872941
complement(283)-t, gdbSNP:201432046
complement(284)-g, adbSNP:140000324
complement(291)-g, adbSNP:147479810
complement(292)-t, cdbSNP:79251149
complement(296)-c, adbSNP:139569235
complement(301)-t, cdbSNP:8193031
complement(326..327)-, gdbSNP:34491912
complement(332)-t, cdbSNP:150599652
complement(336)-t, cdbSNP:374035643
complement(346)-g, adbSNP:200023674
complement(350)-t, cdbSNP:372349270
complement(369)-g, adbSNP:141792428
complement(376)-g, adbSNP:148048398
complement(389)-g, adbSNP:146189995
complement(390)-t, cdbSNP:141492969
complement(394)-t, adbSNP:201400055
405+a, gdbSNP:121918729
complement(409)-t, cdbSNP:2228336
421+a, gdbSNP:41295340
429+a, tdbSNP:398122901
complement(441)-t, cdbSNP:369941973
complement(443)-t, cdbSNP:376728988
complement(463)-dbSNP:
complement(463)-g, adbSNP:144651432
complement(470)-t, cdbSNP:148993226
complement(483)-g, adbSNP:138885883
484+a, gdbSNP:41295444
complement(485)-g, adbSNP:80145541
complement(489)-g, adbSNP:141486741
complement(490)-t, cdbSNP:17102410
500+c, tdbSNP:397514524
complement(501)-t, cdbSNP:200491579
complement(504)-t, cdbSNP:371944908
complement(507)-t, cdbSNP:138592626
518+a, gdbSNP:2229462
complement(520)-g, adbSNP:376590179
complement(521)-t, cdbSNP:141524659
complement(525)-t, cdbSNP:147916609
complement(532)-g, adbSNP:142338588
complement(533)-t, cdbSNP:149089854
complement(535)-g, adbSNP:145002586
complement(542)-t, cdbSNP:149923908
complement(544)-t, cdbSNP:139208806
548+c, tdbSNP:121918716
549+a, gdbSNP:121918718
552+a, gdbSNP:121918719
complement(553)-g, adbSNP:144989372
complement(556)-t, cdbSNP:141559048
complement(587)-g, adbSNP:187901859
complement(588)-t, cdbSNP:374574340
603+c, gdbSNP:121918728
complement(608)-g, adbSNP:199894209
complement(643)-dbSNP:
complement(643)-g, adbSNP:139811103
complement(649)-t, cdbSNP:200092961
complement(650)-t, cdbSNP:374723129
complement(664)-g, adbSNP:145981439
complement(674)-g, adbSNP:200517023
complement(703)-t, cdbSNP:199678720
complement(728)-t, cdbSNP:141685762
complement(731)-g, adbSNP:201167101
complement(747)-t, cdbSNP:369636498
complement(756)-g, adbSNP:200894024
complement(760)-g, adbSNP:377705451
complement(765)-t, cdbSNP:147994543
776+a, gdbSNP:121918732
complement(784)-g, adbSNP:201493499
complement(805)-t, cdbSNP:368775721
complement(808)-t, cdbSNP:369162984
complement(811)-g, adbSNP:143352384
complement(820)-t, cdbSNP:149605227
complement(830)-g, adbSNP:371837832
complement(843)-t, cdbSNP:138574046
complement(848)-t, cdbSNP:201572824
complement(850)-g, adbSNP:35755034
complement(857)-t, cdbSNP:199820979
872+g, tdbSNP:318240748
complement(889)-dbSNP:
complement(889)-g, adbSNP:372360509
complement(895)-g, adbSNP:141590446
complement(912)-t, cdbSNP:367699137
complement(914)-g, adbSNP:201868387
complement(928)-g, adbSNP:200870283
950+a, tdbSNP:397514523
956+a, gdbSNP:121918725
complement(961)-g, adbSNP:370435399
complement(962)-t, cdbSNP:150181059
981+a, gdbSNP:121918727
990+a, c, gdbSNP:121918730
complement(1009)-dbSNP:
complement(1009)-g, adbSNP:186352813
1043+c, g, tdbSNP:121918731
complement(1044)-t, cdbSNP:146770534
complement(1047)-t, cdbSNP:201328637
1067+c, tdbSNP:397514525
complement(1068)-t, c, adbSNP:143473912
1092+a, gdbSNP:121918717
complement(1096)-g, adbSNP:373557209
complement(1167)-dbSNP:
complement(1167)-t, cdbSNP:201379408
complement(1199)-t, cdbSNP:202037016
complement(1224)-t, cdbSNP:139949065
complement(1227)-g, adbSNP:199786703
complement(1237)-g, adbSNP:61747601
1238+a, gdbSNP:41293794
1240+a, cdbSNP:2855005
complement(1267)-c, adbSNP:149449576
1270+a, cdbSNP:1126432
1271+a, gdbSNP:121918722
1290+dbSNP:
1290+a, gdbSNP:121918723
1299+a, gdbSNP:121918726
complement(1308)-g, adbSNP:372498705
1311+a, g, tdbSNP:121918721
complement(1340)-t, cdbSNP:200050519
1347..1351+, acacadbSNP:398122905
complement(1378)-g, adbSNP:150739753
complement(1379)-t, cdbSNP:374898509
1427..1431+dbSNP:
1427..1431+, ttccadbSNP:398122900
complement(1441)-g, adbSNP:141972252
1455..1456+, adbSNP:398122903
1468+a, c, gdbSNP:2855105
complement(1498)-t, cdbSNP:199623333
complement(1527)-dbSNP:
complement(1527)-t, cdbSNP:147078520
complement(1549)-g, adbSNP:369128286
complement(1562)-t, adbSNP:377119683
1573+c, gdbSNP:2748528
1576+c, gdbSNP:2855109
1593+a, gdbSNP:121918724
complement(1597)-t, cdbSNP:187372624
complement(1642)-dbSNP:
complement(1642)-t, cdbSNP:143320733
complement(1643)-g, adbSNP:200829531
1645+c, gdbSNP:2855110
1648+c, gdbSNP:2748529
complement(1652)-t, cdbSNP:7147300
complement(1653)-t, cdbSNP:139320583
complement(1672)-g, adbSNP:201388438
complement(1683)-t, cdbSNP:142404759
1777+dbSNP:
1777+c, g, tdbSNP:2855111
complement(1785)-t, cdbSNP:372839534
complement(1827)-t, cdbSNP:150428149
complement(1851)-g, adbSNP:140363039
complement(1852)-t, cdbSNP:369097812
1868+c, tdbSNP:397514522
complement(1886)-t, cdbSNP:146728175
complement(1887)-g, adbSNP:143322085
complement(1891)-c, adbSNP:141134584
complement(1918)-t, cdbSNP:151000505
complement(1943)-t, cdbSNP:2229464
complement(1967)-g, adbSNP:376000065
complement(2025)-t, gdbSNP:369855757
complement(2030)-t, cdbSNP:148402498
complement(2048)-g, cdbSNP:199735949
complement(2053)-dbSNP:
complement(2053)-t, cdbSNP:200959566
complement(2055)-t, cdbSNP:144489206
complement(2057)-g, adbSNP:144517528
complement(2058)-t, cdbSNP:139837741
complement(2090)-t, gdbSNP:144318024
complement(2091)-t, cdbSNP:369173679
complement(2113)-g, cdbSNP:187050700
2129+a, gdbSNP:2855009
complement(2129)-g, adbSNP:386575416
complement(2146)-t, cdbSNP:140355027
complement(2183)-g, adbSNP:147516124
complement(2193)-g, adbSNP:372829569
complement(2203)-g, adbSNP:143175209
complement(2209)-g, cdbSNP:2855112
complement(2221)-dbSNP:
complement(2221)-t, cdbSNP:369548118
complement(2265)-t, cdbSNP:201733667
complement(2278)-g, adbSNP:377403581
complement(2279)-t, cdbSNP:373148041
complement(2284)-g, adbSNP:139387079
complement(2297)-t, cdbSNP:150686813
complement(2302)-g, cdbSNP:202107026
complement(2303)-g, adbSNP:369781501
complement(2339)-g, adbSNP:377261472
complement(2345)-t, cdbSNP:141864003
complement(2356)-dbSNP:
complement(2356)-g, adbSNP:201121939
complement(2382)-t, cdbSNP:202020907
complement(2383)-g, adbSNP:372243750
complement(2388)-t, g, cdbSNP:35926651
2402+c, tdbSNP:398122904
complement(2414)-g, adbSNP:201853046
complement(2501)-t, cdbSNP:188646084
complement(2518)-g, adbSNP:201811993
complement(2529)-t, adbSNP:2228337
complement(2569)-g, adbSNP:199898319
complement(2580)-g, adbSNP:372231860
2582+c, tdbSNP:2229463
complement(2695..2696)-, acctgagdbSNP:144344499
2696..2717+, ggggagtccagggctcccggagdbSNP:41294726
2696+a, gdbSNP:2748536
complement(2731)-t, adbSNP:186680597
2740+a, cdbSNP:8193035
complement(2740)-t, gdbSNP:386616320
Gene SymbolTGM1
Gene SynonymARCI1; ICR2; KTG; LI; LI1; TGASE; TGK
Chromosome14
Locus Map14q11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000359 Homo sapiens transglutaminase 1 (TGM1), mRNA. In-stock $809.00 $760.00 15
Title Different TGM1 mutation spectra in Italian and Portuguese patients with autosomal recessive congenital ichthyosis: evidence of founder effects in Portugal .
Author Esposito,G., De Falco,F., Neri,I., Graziano,C., Toschi,B., Auricchio,L., Gouveia,C., Sousa,A.B. and Salvatore,F.
Journal Br. J. Dermatol. 168 (6), 1364-1367 (2013)
Title Interactions between FATP4 and ichthyin in epidermal lipid processing may provide clues to the pathogenesis of autosomal recessive congenital ichthyosis .
Author Li H, Vahlquist A and Torma H.
Journal J. Dermatol. Sci. 69 (3), 195-201 (2013)
Title Congenital lamellar ichthyosis in Tunisia is caused by a founder nonsense mutation in the TGM1 gene .
Author Louhichi N, Hadjsalem I, Marrakchi S, Trabelsi F, Masmoudi A, Turki
Journal Mol. Biol. Rep. 40 (3), 2527-2532 (2013)
Title Transglutaminase-1 mutations in Omani families with lamellar ichthyosis .
Author Al-Naamani A, Al-Waily A, Al-Kindi M, Al-Awadi M and Al-Yahyaee SA.
Journal Med Princ Pract 22 (5), 438-443 (2013)
Title Genetic variation in the epidermal transglutaminase genes is not associated with atopic dermatitis .
Author Lieden A, Winge MC, Saaf A, Kockum I, Ekelund E, Rodriguez E, Folster-Holst R, Franke A, Illig T, Tengvall-Linder M, Baurecht H, Weidinger S, Wahlgren CF, Nordenskjold M and Bradley M.
Journal PLoS ONE 7 (11), E49694 (2012)
Title Autosomal Recessive Congenital Ichthyosis .
Author Richard,G. and Bale,S.J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Type I keratinocyte transglutaminase: expression in human skin and psoriasis .
Author Schroeder WT, Thacher SM, Stewart-Galetka S, Annarella M, Chema D, Siciliano MJ, Davies PJ, Tang HY, Sowa BA and Duvic M.
Journal J. Invest. Dermatol. 99 (1), 27-34 (1992)
Title Organization and evolution of the human epidermal keratinocyte transglutaminase I gene .
Author Polakowska RR, Eickbush T, Falciano V, Razvi F and Goldsmith LA.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (10), 4476-4480 (1992)
Title Structure and organization of the human transglutaminase 1 gene .
Author Kim IG, McBride OW, Wang M, Kim SY, Idler WW and Steinert PM.
Journal J. Biol. Chem. 267 (11), 7710-7717 (1992)
Title Genomic structure of keratinocyte transglutaminase. Recruitment of new exon for modified function .
Author Phillips MA, Stewart BE and Rice RH.
Journal J. Biol. Chem. 267 (4), 2282-2286 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.