• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens troponin I type 3 (cardiac) (TNNI3), mRNA.


RefSeq Accession Definition Services Price Order
NM_000363 Homo sapiens troponin I type 3 (cardiac) (TNNI3), mRNA. ORF Sequence $183.57
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000363.4, 151101269
Length 866 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens troponin I type 3 (cardiac) (TNNI3), mRNA.
Product troponin I, cardiac muscle
Comment

Summary: Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. This gene encodes the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues. Mutations in this gene cause familial hypertrophic cardiomyopathy type 7 (CMH7) and familial restrictive cardiomyopathy (RCM). [provided by RefSeq, Jul 2008].

RefSeq NP_000354.4
CDS 144..776
Misc Feature(1)147..149
Misc Feature(2)147..149
Misc Feature(3)156..158
Misc Feature(4)159..161
Misc Feature(5)210..212
Misc Feature(6)213..215
Misc Feature(7)219..221
Misc Feature(8)234..236
Misc Feature(9)237..380
Misc Feature(10)282..674
Misc Feature(11)294..296
Misc Feature(12)372..374
Misc Feature(13)375..377
Misc Feature(14)381..383
Misc Feature(15)432..434
Misc Feature(16)528..590
Misc Feature(17)528..530
Misc Feature(18)570..572
Misc Feature(19)591..593
Misc Feature(20)639..641
Misc Feature(21)684..686
Misc Feature(22)738..740
Exon (1)1..154
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (2)155..167
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (3)168..251
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (4)252..293
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (5)294..425
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (6)426..515
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (7)516..692
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (8)693..843
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Translation MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQE LEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTK NITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKED TEKENREVGDWRKNIDALSGMEGRKKKFES
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(46)-dbSNP:
complement(46)-t, gdbSNP:12973773
complement(59)-t, gdbSNP:186540595
complement(67)-g, adbSNP:181036338
complement(97)-g, adbSNP:202159627
complement(109)-c, adbSNP:3729707
204+dbSNP:
204+c, tdbSNP:267607128
complement(235)-g, adbSNP:201928445
249+a, cdbSNP:267607130
complement(286)-dbSNP:
complement(286)-t, adbSNP:200720341
complement(341)-dbSNP:
complement(341)-g, adbSNP:3729710
complement(347)-t, gdbSNP:3729711
complement(350)-g, cdbSNP:201422579
complement(378)-t, cdbSNP:3729712
complement(387)-g, adbSNP:77615401
complement(416)-t, cdbSNP:75491697
complement(446)-dbSNP:
complement(446)-g, adbSNP:199539066
complement(479..480)-, adbSNP:35173650
complement(499)-t, gdbSNP:184709702
complement(574)-dbSNP:
complement(574)-t, adbSNP:121917760
complement(576)-t, g, cdbSNP:104894724
complement(654)-g, adbSNP:121917761
complement(675)-g, adbSNP:104894730
complement(680)-g, adbSNP:3729841
698+dbSNP:
698+c, gdbSNP:267607129
complement(705)-g, adbSNP:193922409
complement(712)-g, adbSNP:104894728
complement(718)-g, adbSNP:104894729
complement(728)-g, adbSNP:200085986
complement(729)-g, adbSNP:104894727
750+a, gdbSNP:267607127
complement(759)-c, adbSNP:104894725
complement(798)-t, cdbSNP:55792205
complement(818)-t, cdbSNP:184858206
Gene SymbolTNNI3
Gene SynonymCMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Chromosome19
Locus Map19q13.4
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000363 Homo sapiens troponin I type 3 (cardiac) (TNNI3), mRNA. Full Length $251.14
ORF Sequence $183.57
Title Integration of troponin I phosphorylation with cardiac regulatory networks .
Author Solaro,R.J., Henze,M. and Kobayashi,T.
Journal Circ. Res. 112 (2), 355-366 (2013)
Title Impact of site-specific phosphorylation of protein kinase A sites Ser23 and Ser24 of cardiac troponin I in human cardiomyocytes .
Author Wijnker,P.J., Foster,D.B., Tsao,A.L., Frazier,A.H., dos Remedios,C.G., Murphy,A.M., Stienen,G.J. and van der Velden,J.
Journal Am. J. Physiol. Heart Circ. Physiol. 304 (2), H260-H268 (2013)
Title Predictive value of cardiac troponin T and I in hemodialysis patients .
Author Kalaji,F.R. and Albitar,S.
Journal Saudi J Kidney Dis Transpl 23 (5), 939-945 (2012)
Title High prevalence of Arginine to Glutamine substitution at 98, 141 and 162 positions in Troponin I (TNNI3) associated with hypertrophic cardiomyopathy among Indians .
Author Rani,D.S., Nallari,P., Priyamvada,S., Narasimhan,C., Singh,L. and Thangaraj,K.
Journal BMC Med. Genet. 13, 69 (2012)
Title High-sensitivity cardiac troponin-I is elevated in patients with rheumatoid arthritis, independent of cardiovascular risk factors and inflammation .
Author Bradham,W.S., Bian,A., Oeser,A., Gebretsadik,T., Shintani,A., Solus,J., Estis,J., Lu,Q.A., Todd,J., Raggi,P. and Stein,C.M.
Journal PLoS ONE 7 (6), E38930 (2012)
Title The human cardiac troponin I locus: assignment to chromosome 19p13.2-19q13.2 .
Author MacGeoch,C., Barton,P.J., Vallins,W.J., Bhavsar,P. and Spurr,N.K.
Journal Hum. Genet. 88 (1), 101-104 (1991)
Title Troponin I isoform expression in human heart .
Author Hunkeler,N.M., Kullman,J. and Murphy,A.M.
Journal Circ. Res. 69 (5), 1409-1414 (1991)
Title A common motif of two adjacent phosphoserines in bovine, rabbit and human cardiac troponin I .
Author Mittmann,K., Jaquet,K. and Heilmeyer,L.M. Jr.
Journal FEBS Lett. 273 (1-2), 41-45 (1990)
Title Molecular cloning of human cardiac troponin I using polymerase chain reaction .
Author Vallins,W.J., Brand,N.J., Dabhade,N., Butler-Browne,G., Yacoub,M.H. and Barton,P.J.
Journal FEBS Lett. 270 (1-2), 57-61 (1990)
Title Identification of sites phosphorylated in bovine cardiac troponin I and troponin T by protein kinase C and comparative substrate activity of synthetic peptides containing the phosphorylation sites .
Author Noland,T.A. Jr., Raynor,R.L. and Kuo,J.F.
Journal J. Biol. Chem. 264 (34), 20778-20785 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878