• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens troponin I type 3 (cardiac) (TNNI3), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25717 Homo sapiens troponin I type 3 (cardiac) (TNNI3), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu25717C Homo sapiens troponin I type 3 (cardiac) (TNNI3), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000363.4, 151101269
Length 633 bp
Structure linear
Update Date 24-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens troponin I type 3 (cardiac) (TNNI3), mRNA.
Product troponin I, cardiac muscle
Comment

Summary: Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. This gene encodes the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues. Mutations in this gene cause familial hypertrophic cardiomyopathy type 7 (CMH7) and familial restrictive cardiomyopathy (RCM). [provided by RefSeq, Jul 2008].

RefSeq NP_000354.4
CDS 144..776
Misc Feature(1)144..236
Misc Feature(2)144..236
Misc Feature(3)147..149
Misc Feature(4)156..158
Misc Feature(5)159..161
Misc Feature(6)210..212
Misc Feature(7)213..215
Misc Feature(8)219..221
Misc Feature(9)234..236
Misc Feature(10)237..380
Misc Feature(11)294..296
Misc Feature(12)<357..623
Misc Feature(13)372..374
Misc Feature(14)375..377
Misc Feature(15)381..383
Misc Feature(16)432..434
Misc Feature(17)528..590
Misc Feature(18)528..530
Misc Feature(19)570..572
Misc Feature(20)591..593
Misc Feature(21)639..641
Misc Feature(22)684..686
Misc Feature(23)738..740
Exon (1)1..154
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (2)155..167
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (3)168..251
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (4)252..293
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (5)294..425
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (6)426..515
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (7)516..692
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Exon (8)693..843
Gene:TNNI3
Gene Synonym:CMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Translation MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQE LEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTK NITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKED TEKENREVGDWRKNIDALSGMEGRKKKFES
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(46)-dbSNP:
complement(46)-t, gdbSNP:12973773
complement(59)-t, gdbSNP:186540595
complement(67)-g, adbSNP:181036338
complement(71)-g, adbSNP:376861481
complement(97)-g, adbSNP:202159627
109+a, cdbSNP:3729707
complement(128)-g, adbSNP:371665059
144+a, gdbSNP:397516341
148+c, tdbSNP:397516359
149+a, gdbSNP:397516361
182+dbSNP:
182+c, gdbSNP:397516346
complement(188)-t, gdbSNP:377421427
204+c, tdbSNP:267607128
208+a, gdbSNP:397516360
complement(235)-g, adbSNP:201928445
248+a, cdbSNP:397516339
249+a, cdbSNP:267607130
complement(286)-dbSNP:
complement(286)-t, adbSNP:200720341
341+dbSNP:
341+a, gdbSNP:3729710
347+g, tdbSNP:3729711
complement(350)-g, cdbSNP:201422579
complement(363)-t, gdbSNP:375795196
378+c, tdbSNP:3729712
379+g, tdbSNP:397516342
complement(387)-g, adbSNP:77615401
389+g, tdbSNP:397516343
complement(416)-t, cdbSNP:75491697
complement(446)-dbSNP:
complement(446)-g, adbSNP:199539066
complement(447)-t, cdbSNP:374618872
450+c, tdbSNP:397516344
complement(451)-c, adbSNP:371000425
complement(479..480)-, adbSNP:35173650
complement(499)-t, gdbSNP:184709702
complement(506)-g, adbSNP:371490136
511+c, tdbSNP:397516345
complement(527)-dbSNP:
complement(527)-t, cdbSNP:373130533
565+a, gdbSNP:397516347
571+a, cdbSNP:397516348
574+a, c, tdbSNP:121917760
576+c, g, tdbSNP:104894724
577+a, gdbSNP:397516349
605+a, gdbSNP:397516350
607+c, tdbSNP:397516352
613+c, tdbSNP:397516353
complement(627)-g, adbSNP:368861241
628+a, c, gdbSNP:397516354
654+a, gdbSNP:121917761
675..677+, aagdbSNP:397516351
675+a, gdbSNP:104894730
680+a, gdbSNP:3729841
687+a, gdbSNP:397516355
693+dbSNP:
693+a, gdbSNP:397516356
698+c, gdbSNP:267607129
700+a, gdbSNP:397516357
705+a, gdbSNP:193922409
712+a, gdbSNP:104894728
718+a, gdbSNP:104894729
722+c, gdbSNP:397516358
complement(728)-g, adbSNP:200085986
729+a, gdbSNP:104894727
750+a, gdbSNP:267607127
759+a, cdbSNP:104894725
complement(763)-t, cdbSNP:367672692
complement(798)-t, cdbSNP:55792205
complement(811)-g, adbSNP:375447438
complement(818)-t, cdbSNP:184858206
Gene SymbolTNNI3
Gene SynonymCMD1FF; CMD2A; CMH7; cTnI; RCM1; TNNC1
Chromosome19
Locus Map19q13.4
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000363 Homo sapiens troponin I type 3 (cardiac) (TNNI3), mRNA. In-stock $99.00 5-7
Title Early increases in multiple biomarkers predict subsequent cardiotoxicity in patients with breast cancer treated with doxorubicin, taxanes, and trastuzumab .
Author Ky B, Putt M, Sawaya H, French B, Januzzi JL Jr, Sebag IA, Plana JC, Cohen V, Banchs J, Carver JR, Wiegers SE, Martin RP, Picard MH, Gerszten RE, Halpern EF, Passeri J, Kuter I and Scherrer-Crosbie M.
Journal J. Am. Coll. Cardiol. 63 (8), 809-816 (2014)
Title High-sensitivity troponin I for risk assessment in patients with atrial fibrillation: insights from the Apixaban for Reduction in Stroke and other Thromboembolic Events in Atrial Fibrillation (ARISTOTLE) trial .
Author Hijazi Z, Siegbahn A, Andersson U, Granger CB, Alexander JH, Atar D, Gersh BJ, Mohan P, Harjola VP, Horowitz J, Husted S, Hylek EM, Lopes RD, McMurray JJ and Wallentin L.
Journal Circulation 129 (6), 625-634 (2014)
Title Cardiac troponin I in patients with chronic kidney disease stage 3 to 5 in conditions other than acute coronary syndrome .
Author Flores-Solis,L.M. and Hernandez-Dominguez,J.L.
Journal Clin. Lab. 60 (2), 281-290 (2014)
Title Persistently elevated troponin I in paracetamol hepatotoxicity: association with liver injury, organ failure, and outcome .
Author Moore JK, Craig DG, Pryde EA, Walker SW, Beckett GJ, Hayes PC and Simpson KJ.
Journal Clin Toxicol (Phila) 51 (7), 532-539 (2013)
Title Hypertrophic Cardiomyopathy Overview .
Author Cirino,A.L. and Ho,C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Dilated Cardiomyopathy Overview .
Author Hershberger,R.E. and Morales,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title The human cardiac troponin I locus: assignment to chromosome 19p13.2-19q13.2 .
Author MacGeoch C, Barton PJ, Vallins WJ, Bhavsar P and Spurr NK.
Journal Hum. Genet. 88 (1), 101-104 (1991)
Title Troponin I isoform expression in human heart .
Author Hunkeler NM, Kullman J and Murphy AM.
Journal Circ. Res. 69 (5), 1409-1414 (1991)
Title A common motif of two adjacent phosphoserines in bovine, rabbit and human cardiac troponin I .
Author Mittmann K, Jaquet K and Heilmeyer LM Jr.
Journal FEBS Lett. 273 (1-2), 41-45 (1990)
Title Molecular cloning of human cardiac troponin I using polymerase chain reaction .
Author Vallins WJ, Brand NJ, Dabhade N, Butler-Browne G, Yacoub MH and Barton PJ.
Journal FEBS Lett. 270 (1-2), 57-61 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.