• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000364 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_000364.3, 446714949
Length 1195 bp
Structure linear
Update Date 17-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 1, mRNA.
Product troponin T, cardiac muscle isoform 1
Comment

Summary: The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) lacks an in-frame exon in the 3' coding region, compared to variant 5. It encodes a shorter isoform (1) compared to isoform 5.

RefSeq NP_000355.2
CDS 93..980
Misc Feature(1)75..77
Misc Feature(2)399..782
Misc Feature(3)399..782
Misc Feature(4)693..695
Misc Feature(5)705..707
Misc Feature(6)720..722
Misc Feature(7)963..965
Exon (1)1..78
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (2)79..133
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (3)134..144
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (4)145..159
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (5)160..189
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (6)190..255
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (7)256..291
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (8)292..325
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (9)326..386
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (10)387..503
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (11)504..581
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (12)582..692
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (13)693..802
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (14)803..893
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (15)894..934
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (16)935..1182
Gene:TNNT2
Gene Synonym:CMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Translation MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEE EAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHF ENRKKEEEELVSLKDRIERRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAED EARKKKALSNMMHFGGYIQKTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKA KELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
7+dbSNP:
7+a, cdbSNP:45590943
complement(82)-dbSNP:
complement(82)-t, c, adbSNP:201831895
complement(102)-t, gdbSNP:139705141
complement(125)-g, adbSNP:148027842
155+dbSNP:
155+g, tdbSNP:397516477
complement(176)-dbSNP:
complement(176)-t, cdbSNP:370895664
complement(189)-t, cdbSNP:377474357
complement(205)-dbSNP:
complement(205)-t, g, adbSNP:200754249
complement(206)-t, cdbSNP:200283086
228+c, gdbSNP:397516447
complement(258)-dbSNP:
complement(258)-t, cdbSNP:377341875
complement(300)-dbSNP:
complement(300)-t, cdbSNP:141837529
complement(316)-t, gdbSNP:371394312
complement(319..320)-, tdbSNP:34008819
329+dbSNP:
329+a, gdbSNP:3729845
337+a, cdbSNP:386352374
340+a, gdbSNP:397516450
complement(352)-g, adbSNP:144900708
358+a, tdbSNP:121964855
360+c, tdbSNP:397516451
complement(362)-g, c, adbSNP:140245123
373+c, gdbSNP:397516452
374+a, tdbSNP:397516453
379+a, cdbSNP:397516455
386+g, tdbSNP:397516454
complement(395)-dbSNP:
complement(395)-g, adbSNP:267598299
396+c, tdbSNP:397516456
397+a, gdbSNP:121964856
403+a, g, tdbSNP:397516457
405+a, gdbSNP:397516458
413+g, tdbSNP:397516459
440+c, tdbSNP:3729547
447+c, tdbSNP:397516460
450+a, tdbSNP:121964858
complement(473)-t, cdbSNP:201898087
474+a, gdbSNP:397516461
complement(479)-t, cdbSNP:199992160
complement(508)-dbSNP:
complement(508)-t, cdbSNP:2996496
510+c, tdbSNP:397516463
513+c, tdbSNP:74315380
514+a, c, gdbSNP:397516464
522+c, g, tdbSNP:45525839
complement(524)-t, cdbSNP:112453991
complement(527)-g, adbSNP:375675827
complement(528)-t, cdbSNP:371142225
complement(530)-c, adbSNP:141754300
537+c, tdbSNP:397516465
538+a, gdbSNP:397516466
complement(542)-g, adbSNP:200604266
543+a, c, tdbSNP:74315379
complement(566)-g, cdbSNP:35914325
complement(573)-t, cdbSNP:45608937
complement(574)-t, cdbSNP:201048783
595+dbSNP:
595+a, gdbSNP:397516468
597+c, tdbSNP:397516469
complement(598)-g, adbSNP:45501500
609..611+, gagdbSNP:397516470
640+a, gdbSNP:397516471
652+a, cdbSNP:397516473
complement(656)-g, cdbSNP:201270895
complement(657)-c, adbSNP:377157235
659+c, tdbSNP:397516474
complement(696)-dbSNP:
complement(696)-t, cdbSNP:150008205
complement(700)-t, cdbSNP:371047521
721+c, tdbSNP:397516476
726+c, tdbSNP:45586240
727+g, tdbSNP:121964860
741..743+, aagdbSNP:121964859
742..744+, agadbSNP:45578238
complement(742)-t, adbSNP:190805300
762+a, gdbSNP:397516478
765+g, tdbSNP:397516479
complement(775)-t, cdbSNP:45520032
complement(806)-dbSNP:
complement(806)-t, cdbSNP:201229194
complement(829)-g, cdbSNP:2996495
complement(830)-g, cdbSNP:3020555
complement(835)-t, cdbSNP:200500421
845+g, tdbSNP:45466197
complement(847)-g, adbSNP:369181536
857+c, tdbSNP:397516481
complement(858)-t, cdbSNP:141805127
complement(862)-g, adbSNP:376037051
complement(871)-g, adbSNP:3730238
complement(871)-g, adbSNP:386449044
886+a, tdbSNP:397516482
complement(895)-dbSNP:
complement(895)-g, adbSNP:371384395
898+a, gdbSNP:397516483
complement(918)-t, adbSNP:4523540
complement(920)-g, adbSNP:376923877
921+a, gdbSNP:121964861
945+dbSNP:
945+c, tdbSNP:121964857
946+a, gdbSNP:397516484
complement(947)-t, cdbSNP:45503195
965+c, tdbSNP:45465693
complement(966)-t, cdbSNP:147940106
complement(969)-g, adbSNP:367785431
complement(970)-t, c, adbSNP:141121678
complement(989)-g, adbSNP:370503996
complement(1006)-c, adbSNP:375935487
complement(1008)-g, adbSNP:201271311
complement(1017)-g, adbSNP:149240770
complement(1018)-g, cdbSNP:111735792
complement(1046)-g, adbSNP:3729998
complement(1051)-t, cdbSNP:3730244
complement(1103)-g, adbSNP:185927345
Gene SymbolTNNT2
Gene SynonymCMD1D; CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Chromosome1
Locus Map1q32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001276347 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 7, mRNA. On-demand $449.00 14
NM_001001432 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 4, mRNA. On-demand $449.00 14
NM_001001431 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 3, mRNA. On-demand $449.00 14
NM_000364 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 1, mRNA. On-demand $449.00 14
NM_001001430 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 2, mRNA. On-demand $449.00 14
NM_001276346 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 6, mRNA. On-demand $449.00 14
NM_001276345 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 5, mRNA. On-demand $449.00 14
XM_006711508 PREDICTED: Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant X1, mRNA. On-demand $449.00 14
XM_006711509 PREDICTED: Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant X2, mRNA. On-demand $449.00 14
XM_006711510 PREDICTED: Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant X3, mRNA. On-demand $449.00 14
XM_006711511 PREDICTED: Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant X4, mRNA. On-demand $449.00 14
XM_006711512 PREDICTED: Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant X5, mRNA. On-demand $449.00 14
XM_006711513 PREDICTED: Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant X6, mRNA. On-demand $449.00 14
XM_006711514 PREDICTED: Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant X7, mRNA. On-demand $449.00 14
Title Clinical value of plasma pentraxin 3 levels for predicting cardiac troponin elevation after percutaneous coronary intervention .
Author Wang Z, Sato A, Akiyama D, Kimura T, Tajiri K, Hoshi T, Sakai S, Koike A, Miyauchi T and Aonuma K.
Journal Life Sci. 95 (1), 40-44 (2014)
Title Troponin T and N-terminal pro-B-type natriuretic peptide: a biomarker approach to predict heart failure risk--the atherosclerosis risk in communities study .
Author Nambi V, Liu X, Chambless LE, de Lemos JA, Virani SS, Agarwal S, Boerwinkle E, Hoogeveen RC, Aguilar D, Astor BC, Srinivas PR, Deswal A, Mosley TH, Coresh J, Folsom AR, Heiss G and Ballantyne CM.
Journal Clin. Chem. 59 (12), 1802-1810 (2013)
Title Screening of MYH7, MYBPC3, and TNNT2 genes in Brazilian patients with hypertrophic cardiomyopathy .
Author Marsiglia JD, Credidio FL, de Oliveira TG, Reis RF, Antunes Mde O, de Araujo AQ, Pedrosa RP, Barbosa-Ferreira JM, Mady C, Krieger JE, Arteaga-Fernandez E and Pereira Ada C.
Journal Am. Heart J. 166 (4), 775-782 (2013)
Title Predictors of high sensitivity cardiac troponin T in chronic kidney disease patients: a cross-sectional study in the chronic renal insufficiency cohort (CRIC) .
Author Dubin RF, Li Y, He J, Jaar BG, Kallem R, Lash JP, Makos G, Rosas SE, Soliman EZ, Townsend RR, Yang W, Go AS, Keane M, Defilippi C, Mishra R, Wolf M and Shlipak MG.
Journal BMC Nephrol 14, 229 (2013)
Title Hypertrophic Cardiomyopathy Overview .
Author Cirino,A.L. and Ho,C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Dilated Cardiomyopathy Overview .
Author Hershberger,R.E. and Morales,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Identification of sites phosphorylated in bovine cardiac troponin I and troponin T by protein kinase C and comparative substrate activity of synthetic peptides containing the phosphorylation sites .
Author Noland TA Jr, Raynor RL and Kuo JF.
Journal J. Biol. Chem. 264 (34), 20778-20785 (1989)
Title Ca2+, pH and the regulation of cardiac myofilament force and ATPase activity .
Author Solaro RJ, el-Saleh SC and Kentish JC.
Journal Mol. Cell. Biochem. 89 (2), 163-167 (1989)
Title Developmentally induced, muscle-specific trans factors control the differential splicing of alternative and constitutive troponin T exons .
Author Breitbart,R.E. and Nadal-Ginard,B.
Journal Cell 49 (6), 793-803 (1987)
Title A novel mechanism of alternative RNA splicing for the developmentally regulated generation of troponin T isoforms from a single gene .
Author Medford,R.M., Nguyen,H.T., Destree,A.T., Summers,E. and Nadal-Ginard,B.
Journal Cell 38 (2), 409-421 (1984)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.