• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000364 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_000364.3, 446714949
Length 1195 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 1, mRNA.
Product troponin T, cardiac muscle isoform 1
Comment

Summary: The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) lacks an in-frame exon in the 3' coding region, compared to variant 5. It encodes a shorter isoform (1) compared to isoform 5.

RefSeq NP_000355.2
CDS 93..980
Misc Feature(1)75..77
Misc Feature(2)75..77
Misc Feature(3)399..>497
Misc Feature(4)399..>497
Misc Feature(5)693..695
Misc Feature(6)<699..824
Misc Feature(7)705..707
Misc Feature(8)720..722
Misc Feature(9)963..965
Exon (1)1..78
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (2)79..133
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (3)134..144
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (4)145..159
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (5)160..189
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (6)190..255
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (7)256..291
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (8)292..325
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (9)326..386
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (10)387..503
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (11)504..581
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (12)582..692
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (13)693..802
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (14)803..893
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (15)894..934
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Exon (16)935..1182
Gene:TNNT2
Gene Synonym:CMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Translation MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEE EAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHF ENRKKEEEELVSLKDRIERRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAED EARKKKALSNMMHFGGYIQKTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKA KELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolTNNT2
Gene SynonymCMH2; CMPD2; cTnT; LVNC6; RCM3; TnTC
Chromosome1
Locus Map1q32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000364 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 1, mRNA. On-demand $449.00 14
NM_001001430 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 2, mRNA. On-demand $449.00 14
NM_001001431 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 3, mRNA. On-demand $449.00 14
NM_001001432 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 4, mRNA. On-demand $449.00 14
NM_001276345 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 5, mRNA. On-demand $449.00 14
NM_001276346 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 6, mRNA. On-demand $449.00 14
NM_001276347 Homo sapiens troponin T type 2 (cardiac) (TNNT2), transcript variant 7, mRNA. On-demand $449.00 14
Title Troponin T, B-type natriuretic peptide, C-reactive protein, and cause-specific mortality .
Author Oluleye,O.W., Folsom,A.R., Nambi,V., Lutsey,P.L. and Ballantyne,C.M.
Journal Ann Epidemiol 23 (2), 66-73 (2013)
Title Predictive value of cardiac troponin T and I in hemodialysis patients .
Author Kalaji,F.R. and Albitar,S.
Journal Saudi J Kidney Dis Transpl 23 (5), 939-945 (2012)
Title Troponin T for the detection of dialysis-induced myocardial stunning in hemodialysis patients .
Author Breidthardt,T., Burton,J.O., Odudu,A., Eldehni,M.T., Jefferies,H.J. and McIntyre,C.W.
Journal Clin J Am Soc Nephrol 7 (8), 1285-1292 (2012)
Title The C-terminus of troponin T is essential for maintaining the inactive state of regulated actin .
Author Franklin,A.J., Baxley,T., Kobayashi,T. and Chalovich,J.M.
Journal Biophys. J. 102 (11), 2536-2544 (2012)
Title Prognostic significance of elevated cardiac troponin-T levels in acute respiratory distress syndrome patients .
Author Rivara,M.B., Bajwa,E.K., Januzzi,J.L., Gong,M.N., Thompson,B.T. and Christiani,D.C.
Journal PLoS ONE 7 (7), E40515 (2012)
Title Identification of sites phosphorylated in bovine cardiac troponin I and troponin T by protein kinase C and comparative substrate activity of synthetic peptides containing the phosphorylation sites .
Author Noland,T.A. Jr., Raynor,R.L. and Kuo,J.F.
Journal J. Biol. Chem. 264 (34), 20778-20785 (1989)
Title Ca2+, pH and the regulation of cardiac myofilament force and ATPase activity .
Author Solaro,R.J., el-Saleh,S.C. and Kentish,J.C.
Journal Mol. Cell. Biochem. 89 (2), 163-167 (1989)
Title Developmentally induced, muscle-specific trans factors control the differential splicing of alternative and constitutive troponin T exons .
Author Breitbart,R.E. and Nadal-Ginard,B.
Journal Cell 49 (6), 793-803 (1987)
Title A novel mechanism of alternative RNA splicing for the developmentally regulated generation of troponin T isoforms from a single gene .
Author Medford,R.M., Nguyen,H.T., Destree,A.T., Summers,E. and Nadal-Ginard,B.
Journal Cell 38 (2), 409-421 (1984)
Title Interactions among chymotryptic troponin T subfragments, tropomyosin, troponin I and troponin C .
Author Tanokura,M. and Ohtsuki,I.
Journal J. Biochem. 95 (5), 1417-1421 (1984)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.