• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 5, mRNA.


RefSeq Accession Definition Services Price Order
NM_000366 Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 5, mRNA. ORF Sequence $247.95
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000366.5, 63252894
Length 1294 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 5, mRNA.
Product tropomyosin alpha-1 chain isoform 5
Comment

Summary: This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, alternatively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (5) contains an alternate, in-frame exon and uses an alternate in-frame splice site and upstream stop codon, compared to variant 1. It encodes isoform 5, which has a different C-terminus, compared to isoform 1.

RefSeq NP_000357.3
CDS 192..1046
Misc Feature(1)192..194
Misc Feature(2)192..194
Misc Feature(3)333..1043
Misc Feature(4)1038..1040
Exon (1)1..305
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; TMSA
Exon (2)306..431
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; TMSA
Exon (3)432..565
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; TMSA
Exon (4)566..683
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; TMSA
Exon (5)684..754
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; TMSA
Exon (6)755..830
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; TMSA
Exon (7)831..893
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; TMSA
Exon (8)894..963
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; TMSA
Exon (9)964..1090
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; TMSA
Exon (10)1091..1288
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; TMSA
Translation MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE ERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSDKLKEAETRAE FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
126+dbSNP:
126+c, tdbSNP:193170738
127+c, tdbSNP:34325439
236+g, tdbSNP:199476301
258+c, gdbSNP:199476302
300+a, gdbSNP:199476303
309+dbSNP:
309+a, gdbSNP:104894501
329+a, gdbSNP:200509525
351+a, gdbSNP:104894505
363+c, gdbSNP:199476304
365+c, tdbSNP:11558750
368+a, gdbSNP:149346709
371+c, tdbSNP:17850194
375+c, gdbSNP:199476305
379+c, tdbSNP:199476306
400+a, cdbSNP:199476307
440+dbSNP:
440+c, tdbSNP:200257214
466+c, tdbSNP:199476310
475+c, tdbSNP:104894504
479+a, gdbSNP:192883939
499+a, gdbSNP:112125078
572+dbSNP:
572+a, gdbSNP:201211957
594+a, cdbSNP:11558749
644+a, cdbSNP:1071646
665+c, tdbSNP:143922069
670+a, gdbSNP:199476311
677+c, tdbSNP:11558747
698+dbSNP:
698+a, gdbSNP:139663836
706+c, tdbSNP:199476312
713+c, tdbSNP:200173919
714+a, gdbSNP:104894503
730+a, g, tdbSNP:104894502
740+g, tdbSNP:199476313
745+g, tdbSNP:199476314
762+dbSNP:
762+c, tdbSNP:201813515
763+a, gdbSNP:141757680
785+a, tdbSNP:200794206
809+a, gdbSNP:144700226
835+dbSNP:
835+c, tdbSNP:199476316
864+a, gdbSNP:193922410
879+a, gdbSNP:199476317
906+dbSNP:
906+a, gdbSNP:199476318
917+a, gdbSNP:200484871
933+a, gdbSNP:199476319
959+a, gdbSNP:139650306
1020+dbSNP:
1020+a, gdbSNP:149659674
1021+c, tdbSNP:199476320
1033+c, tdbSNP:199476321
1041+a, gdbSNP:199476322
1043+a, c, gdbSNP:112674117
1083+a, tdbSNP:3218718
1086+a, cdbSNP:191558659
1115+dbSNP:
1115+a, cdbSNP:146861835
1131+a, gdbSNP:201563826
1170+a, gdbSNP:140658011
1193+c, gdbSNP:150024529
1233+c, tdbSNP:145513507
1239+a, gdbSNP:148842623
1242+g, tdbSNP:7668
Gene SymbolTPM1
Gene SynonymC15orf13; CMD1Y; CMH3; HTM-alpha; TMSA
Chromosome15
Locus Map15q22.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000366 Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 5, mRNA. Full Length $375.26
ORF Sequence $247.95
NM_001018004 Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 3, mRNA. Full Length $521.13
ORF Sequence $247.95
NM_001018005 Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 1, mRNA. Full Length $361.34
ORF Sequence $247.95
NM_001018006 Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 4, mRNA. Full Length $521.13
ORF Sequence $247.95
NM_001018007 Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 2, mRNA. Full Length $521.13
ORF Sequence $247.95
NM_001018008 Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 6, mRNA. Full Length $454.14
ORF Sequence $214.02
NM_001018020 Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 7, mRNA. Full Length $521.13
ORF Sequence $247.95
Title Functional structure of the promoter regions for the predominant low molecular weight isoforms of tropomyosin in human kidney cells .
Author Savill,S.A., Leitch,H.F., Harvey,J.N. and Thomas,T.H.
Journal J. Cell. Biochem. 113 (11), 3576-3586 (2012)
Title Downregulation of tropomyosin-1 in squamous cell carcinoma of esophagus, the role of Ras signaling and methylation .
Author Zare,M., Jazii,F.R., Soheili,Z.S. and Moghanibashi,M.M.
Journal Mol. Carcinog. 51 (10), 796-806 (2012)
Title Familial hypertrophic cardiomyopathy related E180G mutation increases flexibility of human cardiac alpha-tropomyosin .
Author Loong,C.K., Zhou,H.X. and Chase,P.B.
Journal FEBS Lett. 586 (19), 3503-3507 (2012)
Title Genome-wide meta-analyses of nonsyndromic cleft lip with or without cleft palate identify six new risk loci .
Author Ludwig,K.U., Mangold,E., Herms,S., Nowak,S., Reutter,H., Paul,A., Becker,J., Herberz,R., AlChawa,T., Nasser,E., Bohmer,A.C., Mattheisen,M., Alblas,M.A., Barth,S., Kluck,N., Lauster,C., Braumann,B., Reich,R.H., Hemprich,A., Potzsch,S., Blaumeiser,B., Daratsianos,N., Kreusch,T., Murray,J.C., Marazita,M.L., Ruczinski,I., Scott,A.F., Beaty,T.H., Kramer,F.J., Wienker,T.F., Steegers-Theunissen,R.P., Rubini,M., Mossey,P.A., Hoffmann,P., Lange,C., Cichon,S., Propping,P., Knapp,M. and Nothen,M.M.
Journal Nat. Genet. 44 (9), 968-971 (2012)
Title The flexibility of two tropomyosin mutants, D175N and E180G, that cause hypertrophic cardiomyopathy .
Author Li,X.E., Suphamungmee,W., Janco,M., Geeves,M.A., Marston,S.B., Fischer,S. and Lehman,W.
Journal Biochem. Biophys. Res. Commun. 424 (3), 493-496 (2012)
Title Protein interaction cloning in yeast: identification of mammalian proteins that react with the leucine zipper of Jun .
Author Chevray,P.M. and Nathans,D.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (13), 5789-5793 (1992)
Title The molecular basis for tropomyosin isoform diversity .
Author Lees-Miller,J.P. and Helfman,D.M.
Journal Bioessays 13 (9), 429-437 (1991)
Title The amino terminus of muscle tropomyosin is a major determinant for function .
Author Cho,Y.J., Liu,J. and Hitchcock-DeGregori,S.E.
Journal J. Biol. Chem. 265 (1), 538-545 (1990)
Title Evolution of tropomyosin functional domains: differential splicing and genomic constraints .
Author Colote,S., Widada,J.S., Ferraz,C., Bonhomme,F., Marti,J. and Liautard,J.P.
Journal J. Mol. Evol. 27 (3), 228-235 (1988)
Title Specific phosphorylation at serine-283 of alpha tropomyosin from frog skeletal and rabbit skeletal and cardiac muscle .
Author Mak,A., Smillie,L.B. and Barany,M.
Journal Proc. Natl. Acad. Sci. U.S.A. 75 (8), 3588-3592 (1978)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878