• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 5, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu16327 Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 5, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu16327C Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 5, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000366.5, 63252894
Length 855 bp
Structure linear
Update Date 19-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 5, mRNA.
Product tropomyosin alpha-1 chain isoform 5
Comment

Summary: This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, alternatively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (5) contains an alternate, in-frame exon and uses an alternate in-frame splice site and upstream stop codon, compared to variant 1. It encodes isoform 5, which has a different C-terminus, compared to isoform 1.

RefSeq NP_000357.3
CDS 192..1046
Misc Feature(1)192..194
Misc Feature(2)192..194
Misc Feature(3)210..650
Misc Feature(4)333..1043
Misc Feature(5)1038..1040
Exon (1)1..305
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; LVNC9; TMSA
Exon (2)306..431
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; LVNC9; TMSA
Exon (3)432..565
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; LVNC9; TMSA
Exon (4)566..683
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; LVNC9; TMSA
Exon (5)684..754
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; LVNC9; TMSA
Exon (6)755..830
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; LVNC9; TMSA
Exon (7)831..893
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; LVNC9; TMSA
Exon (8)894..963
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; LVNC9; TMSA
Exon (9)964..1090
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; LVNC9; TMSA
Exon (10)1091..1288
Gene:TPM1
Gene Synonym:C15orf13; CMD1Y; CMH3; HTM-alpha; LVNC9; TMSA
Translation MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE ERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSDKLKEAETRAE FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
126+dbSNP:
126+c, tdbSNP:193170738
127+c, tdbSNP:34325439
145+a, gdbSNP:372760316
146+c, tdbSNP:374752523
185+c, tdbSNP:370871307
192+a, gdbSNP:367543668
193+, tdbSNP:397516366
214+g, tdbSNP:397516364
218+a, gdbSNP:397516365
236+g, tdbSNP:199476301
255+a, gdbSNP:397516382
258+c, gdbSNP:199476302
273+a, c, gdbSNP:397516391
282+a, gdbSNP:397516396
288+a, gdbSNP:397516397
300+a, gdbSNP:199476303
309+dbSNP:
309+a, g, tdbSNP:104894501
329+a, gdbSNP:200509525
351+a, gdbSNP:104894505
354+a, gdbSNP:397516363
363+c, gdbSNP:199476304
365+c, tdbSNP:11558750
368+a, gdbSNP:149346709
371+c, tdbSNP:17850194
375+c, gdbSNP:199476305
379+c, tdbSNP:199476306
400+a, cdbSNP:199476307
440+dbSNP:
440+c, tdbSNP:200257214
443+c, g, tdbSNP:369617788
466+c, tdbSNP:199476310
475+c, tdbSNP:104894504
479+a, gdbSNP:192883939
496+a, cdbSNP:397516367
499+a, gdbSNP:112125078
512+a, cdbSNP:397516368
528+c, gdbSNP:397516369
532+a, gdbSNP:397516370
572+dbSNP:
572+a, gdbSNP:201211957
594+a, cdbSNP:11558749
614+c, gdbSNP:397516371
635+c, gdbSNP:376518788
644+a, cdbSNP:1071646
648+c, gdbSNP:397516372
665+c, tdbSNP:143922069
666+a, gdbSNP:397516373
670+a, gdbSNP:199476311
677+c, tdbSNP:11558747
698+dbSNP:
698+a, gdbSNP:139663836
706+c, tdbSNP:199476312
713+c, tdbSNP:200173919
714+a, gdbSNP:104894503
723+c, tdbSNP:367606352
724+a, gdbSNP:397516375
730+a, g, tdbSNP:104894502
739+c, tdbSNP:397516376
740+c, g, tdbSNP:199476313
745+g, tdbSNP:199476314
762+dbSNP:
762+c, tdbSNP:201813515
763+a, gdbSNP:141757680
785+a, tdbSNP:200794206
809+a, gdbSNP:144700226
835+dbSNP:
835+c, tdbSNP:199476316
864+a, gdbSNP:193922410
867+a, cdbSNP:397516383
875+c, tdbSNP:397516384
879+a, gdbSNP:199476317
883+a, gdbSNP:397516385
903+dbSNP:
903+c, tdbSNP:397516386
906+a, gdbSNP:199476318
916+c, tdbSNP:397516387
917+a, gdbSNP:200484871
925+c, tdbSNP:397516388
933+a, gdbSNP:199476319
959+a, gdbSNP:139650306
966+dbSNP:
966+a, gdbSNP:397516389
981+a, gdbSNP:397516390
988+a, gdbSNP:371934474
1019+c, tdbSNP:368813394
1020+a, gdbSNP:149659674
1021+c, g, tdbSNP:199476320
1026+a, cdbSNP:397516392
1028+c, tdbSNP:397516393
1032+a, gdbSNP:397516394
1033+c, tdbSNP:199476321
1036+c, gdbSNP:397516395
1041+a, gdbSNP:199476322
1043+a, c, gdbSNP:112674117
1048+c, tdbSNP:375043184
1052+c, gdbSNP:369151855
1067+c, tdbSNP:373572071
1075+c, tdbSNP:376843038
1083+a, tdbSNP:3218718
1086+a, cdbSNP:191558659
1115+dbSNP:
1115+a, cdbSNP:146861835
1131+a, gdbSNP:201563826
1162+a, gdbSNP:374459540
1170+a, gdbSNP:140658011
1193+c, gdbSNP:150024529
1233+c, tdbSNP:145513507
1239+a, gdbSNP:148842623
1242+g, tdbSNP:7668
Gene SymbolTPM1
Gene SynonymC15orf13; CMD1Y; CMH3; HTM-alpha; LVNC9; TMSA
Chromosome15
Locus Map15q22.1
Title Protein isoform-specific validation defines multiple chloride intracellular channel and tropomyosin isoforms as serological biomarkers of ovarian cancer .
Author Tang HY, Beer LA, Tanyi JL, Zhang R, Liu Q and Speicher DW.
Journal J Proteomics 89, 165-178 (2013)
Title A periodic pattern of evolutionarily conserved basic and acidic residues constitutes the binding interface of actin-tropomyosin .
Author Barua B, Fagnant PM, Winkelmann DA, Trybus KM and Hitchcock-DeGregori SE.
Journal J. Biol. Chem. 288 (14), 9602-9609 (2013)
Title Genetic and epigenetic alterations are involved in the regulation of TPM1 in cholangiocarcinoma .
Author Yang W, Wang X, Zheng W, Li K, Liu H and Sun Y.
Journal Int. J. Oncol. 42 (2), 690-698 (2013)
Title Somatic MYH7, MYBPC3, TPM1, TNNT2 and TNNI3 mutations in sporadic hypertrophic cardiomyopathy .
Author Nunez L, Gimeno-Blanes JR, Rodriguez-Garcia MI, Monserrat L, Zorio E, Coats C, McGregor CG, Hernandez del Rincon JP, Castro-Beiras A and Hermida-Prieto M.
Journal Circ. J. 77 (9), 2358-2365 (2013)
Title Hypertrophic Cardiomyopathy Overview .
Author Cirino,A.L. and Ho,C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Dilated Cardiomyopathy Overview .
Author Hershberger,R.E. and Morales,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Protein interaction cloning in yeast: identification of mammalian proteins that react with the leucine zipper of Jun .
Author Chevray PM and Nathans D.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (13), 5789-5793 (1992)
Title The molecular basis for tropomyosin isoform diversity .
Author Lees-Miller JP and Helfman DM.
Journal Bioessays 13 (9), 429-437 (1991)
Title The amino terminus of muscle tropomyosin is a major determinant for function .
Author Cho YJ, Liu J and Hitchcock-DeGregori SE.
Journal J. Biol. Chem. 265 (1), 538-545 (1990)
Title Specific phosphorylation at serine-283 of alpha tropomyosin from frog skeletal and rabbit skeletal and cardiac muscle .
Author Mak,A., Smillie,L.B. and Barany,M.
Journal Proc. Natl. Acad. Sci. U.S.A. 75 (8), 3588-3592 (1978)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.