• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens Wilms tumor 1 (WT1), transcript variant A, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27056 Homo sapiens Wilms tumor 1 (WT1), transcript variant A, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu27056C Homo sapiens Wilms tumor 1 (WT1), transcript variant A, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000378.4, 309951094
Length 1494 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens Wilms tumor 1 (WT1), transcript variant A, mRNA.
Product Wilms tumor protein isoform A
Comment

Summary: This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilm's tumors. This gene exhibits complex tissue-specific and polymorphic imprinting pattern, with biallelic, and monoallelic expression from the maternal and paternal alleles in different tissues. Multiple transcript variants have been described. In several variants, there is evidence for the use of a non-AUG (CUG) translation initiation site upstream of and in-frame with the first AUG. Authors of PMID:7926762 also provide evidence that WT1 mRNA undergoes RNA editing in human and rat, and that this process is tissue-restricted and developmentally regulated. [provided by RefSeq, Oct 2010].


Transcript Variant: This variant (A) lacks an alternate in-frame exon and uses an alternate, in-frame splice site in the 3' coding region, compared to variant D. This results in a shorter protein (isoform A), compared to isoform D. It initiates translation from a non-AUG (CUG) site, and also from a downstream, in-frame AUG.

RefSeq NP_000369.3
CDS 191..1684
Misc Feature(1)395..1306
Misc Feature(2)395..1306
Misc Feature(3)<728..1657
Misc Feature(4)1358..1441
Misc Feature(5)1436..1438
Misc Feature(6)1451..1525
Misc Feature(7)1520..1522
Misc Feature(8)1532..1615
Misc Feature(9)395..397
Misc Feature(10)1185
Exon (1)1..836
Gene:WT1
Gene Synonym:AWT1; EWS-WT1; GUD; NPHS4; WAGR; WIT-2; WT33
Exon (2)837..959
Gene:WT1
Gene Synonym:AWT1; EWS-WT1; GUD; NPHS4; WAGR; WIT-2; WT33
Exon (3)960..1062
Gene:WT1
Gene Synonym:AWT1; EWS-WT1; GUD; NPHS4; WAGR; WIT-2; WT33
Exon (4)1063..1140
Gene:WT1
Gene Synonym:AWT1; EWS-WT1; GUD; NPHS4; WAGR; WIT-2; WT33
Exon (5)1141..1237
Gene:WT1
Gene Synonym:AWT1; EWS-WT1; GUD; NPHS4; WAGR; WIT-2; WT33
Exon (6)1238..1388
Gene:WT1
Gene Synonym:AWT1; EWS-WT1; GUD; NPHS4; WAGR; WIT-2; WT33
Exon (7)1389..1478
Gene:WT1
Gene Synonym:AWT1; EWS-WT1; GUD; NPHS4; WAGR; WIT-2; WT33
Exon (8)1479..1562
Gene:WT1
Gene Synonym:AWT1; EWS-WT1; GUD; NPHS4; WAGR; WIT-2; WT33
Exon (9)1563..2967
Gene:WT1
Gene Synonym:AWT1; EWS-WT1; GUD; NPHS4; WAGR; WIT-2; WT33
Translation MQDPASTCVPEPASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRG ASGSEPQQMGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASAYGSLG GPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPF GPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFP NHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQ LECMTWNQMNLGATLKGHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDVRRVPGVAPT LVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQ LKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELV RHHNMHQRNMTKLQLAL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
101+c, tdbSNP:5030133
356+a, cdbSNP:2234581
complement(368)-t, cdbSNP:374404615
complement(388)-t, gdbSNP:2234582
391+g, tdbSNP:5030135
520+c, tdbSNP:1799925
complement(718)-g, adbSNP:369870529
721+a, cdbSNP:121907911
complement(742)-c, adbSNP:141135091
complement(767)-c, adbSNP:377072761
complement(784)-t, cdbSNP:2234583
785+a, gdbSNP:9332973
complement(833)-t, gdbSNP:373935628
complement(837)-dbSNP:
complement(837)-t, cdbSNP:369444006
871+c, tdbSNP:9332974
complement(886)-g, adbSNP:183263057
935+c, tdbSNP:2234584
complement(938)-t, cdbSNP:142653301
complement(939)-t, adbSNP:377573993
complement(960)-dbSNP:
complement(960)-t, cdbSNP:372225738
complement(1000)-g, cdbSNP:200222400
complement(1005)-g, adbSNP:138073760
complement(1024)-g, adbSNP:145425799
complement(1034)-c, adbSNP:368452754
complement(1075)-dbSNP:
complement(1075)-g, adbSNP:190440703
complement(1086)-g, adbSNP:267602852
complement(1131)-t, gdbSNP:372630828
complement(1144)-dbSNP:
complement(1144)-g, adbSNP:375114529
complement(1146)-t, cdbSNP:371021920
1160+a, gdbSNP:121907908
complement(1163)-t, cdbSNP:267602851
complement(1187)-g, adbSNP:142059681
complement(1198)-g, adbSNP:2234590
complement(1207)-t, cdbSNP:17855567
complement(1224)-c, adbSNP:150194429
1246+dbSNP:
1246+a, gdbSNP:16754
complement(1246)-g, adbSNP:386540677
complement(1255)-g, adbSNP:151034312
complement(1264)-t, gdbSNP:147126640
complement(1270)-t, adbSNP:371168589
complement(1278)-t, cdbSNP:147241955
complement(1281)-g, cdbSNP:142937387
complement(1282)-t, cdbSNP:377446096
complement(1285)-t, cdbSNP:141834493
complement(1306)-g, adbSNP:147939483
complement(1307)-g, adbSNP:267602850
complement(1312)-g, adbSNP:200539928
1332+a, gdbSNP:121907904
complement(1377)-c, adbSNP:373176048
1421+dbSNP:
1421+g, tdbSNP:121907905
1427+c, tdbSNP:121907906
complement(1428)-t, cdbSNP:144788858
complement(1430)-t, cdbSNP:77183751
1439+c, tdbSNP:121907910
1440+a, gdbSNP:121907901
1462+c, gdbSNP:121907907
1472+c, tdbSNP:28942089
1490+dbSNP:
1490+c, tdbSNP:28941777
1511+c, tdbSNP:121907909
1517+c, tdbSNP:28941779
1523+c, tdbSNP:121907900
1524+c, gdbSNP:121907903
complement(1528)-g, adbSNP:374799820
1529+a, gdbSNP:28941778
1530+a, gdbSNP:121907902
complement(1578)-t, cdbSNP:267602849
complement(1584)-t, cdbSNP:139893274
complement(1642)-g, cdbSNP:369940913
complement(1669)-g, adbSNP:267602848
complement(1678)-t, cdbSNP:202118284
complement(1683)-t, cdbSNP:148856160
complement(1696)-g, adbSNP:77462662
complement(1700)-t, gdbSNP:2234594
complement(1719)-t, gdbSNP:376972948
1772+a, gdbSNP:5030315
complement(1772)-g, adbSNP:386597368
complement(1822)-t, cdbSNP:111351882
1908+a, gdbSNP:5030316
complement(1908)-t, cdbSNP:386597369
1951+c, gdbSNP:5030317
complement(1964)-c, adbSNP:181881769
complement(2029)-g, adbSNP:5030318
complement(2149)-t, gdbSNP:189407871
complement(2198)-t, cdbSNP:372622383
complement(2226)-t, cdbSNP:142726499
complement(2257..2258)-, cdbSNP:79335260
complement(2257..2258)-, cdbSNP:386597370
2258+, gdbSNP:5030319
2286+a, gdbSNP:5030320
complement(2286)-g, adbSNP:386597371
complement(2350)-t, cdbSNP:374306749
complement(2458)-t, gdbSNP:184847211
2481+c, tdbSNP:148478722
complement(2504)-g, cdbSNP:1042347
complement(2519)-g, adbSNP:5030322
complement(2548)-t, g, adbSNP:5030323
complement(2581)-g, cdbSNP:5030324
complement(2587)-g, adbSNP:5030325
complement(2656..2657)-, tdbSNP:72519751
complement(2662..2663)-, tdbSNP:386597372
complement(2662..2663)-, adbSNP:5030326
complement(2705..2708)-, acacdbSNP:58549495
complement(2733..2738)-, acacacdbSNP:147708114
complement(2737..2738)-, acdbSNP:200382866
2746..2747+(tg)19, 20, 21, 22, 23dbSNP:3138550
complement(2782)-t, cdbSNP:5030327
complement(2816)-t, adbSNP:5030328
complement(2893)-g, adbSNP:5030329
Gene SymbolWT1
Gene SynonymAWT1; EWS-WT1; GUD; NPHS4; WAGR; WIT-2; WT33
Chromosome11
Locus Map11p13
Title Correlation of Wilms' tumor 1 isoforms with HER2 and ER-alpha and its oncogenic role in breast cancer .
Author Nasomyon T, Samphao S, Sangkhathat S, Mahattanobon S and Graidist P.
Journal Anticancer Res. 34 (3), 1333-1342 (2014)
Title Insulin-like growth factor I regulates the expression of isoforms of Wilms' tumor 1 gene in breast cancer .
Author Tuna,M. and Itamochi,H.
Journal Tumori 99 (6), 715-722 (2013)
Title The complex life of WT1 .
Author Wagner KD, Wagner N and Schedl A.
Journal J. Cell. Sci. 116 (PT 9), 1653-1658 (2003)
Title Paternal expression of WT1 in human fibroblasts and lymphocytes .
Author Mitsuya K, Sui H, Meguro M, Kugoh H, Jinno Y, Niikawa N and Oshimura M.
Journal Hum. Mol. Genet. 6 (13), 2243-2246 (1997)
Title A non-AUG translational initiation event generates novel WT1 isoforms .
Author Bruening W and Pelletier J.
Journal J. Biol. Chem. 271 (15), 8646-8654 (1996)
Title RNA editing in the Wilms' tumor susceptibility gene, WT1 .
Author Sharma PM, Bowman M, Madden SL, Rauscher FJ 3rd and Sukumar S.
Journal Genes Dev. 8 (6), 720-731 (1994)
Title Mosaic and polymorphic imprinting of the WT1 gene in humans .
Author Jinno Y, Yun K, Nishiwaki K, Kubota T, Ogawa O, Reeve AE and Niikawa N.
Journal Nat. Genet. 6 (3), 305-309 (1994)
Title Congenital Diaphragmatic Hernia Overview .
Author Pober,B.R., Russell,M.K. and Ackerman,K.G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Wilms Tumor Overview .
Author Dome,J.S. and Huff,V.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Germline intronic and exonic mutations in the Wilms' tumour gene (WT1) affecting urogenital development .
Author Bruening W, Bardeesy N, Silverman BL, Cohn RA, Machin GA, Aronson AJ, Housman D and Pelletier J.
Journal Nat. Genet. 1 (2), 144-148 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.