• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tripeptidyl peptidase I (TPP1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu28414 Homo sapiens tripeptidyl peptidase I (TPP1), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu28414C Homo sapiens tripeptidyl peptidase I (TPP1), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000391.3, 118582287
Length 1692 bp
Structure linear
Update Date 23-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens tripeptidyl peptidase I (TPP1), mRNA.
Product tripeptidyl-peptidase 1 preproprotein
Comment

Summary: This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome. [provided by RefSeq, Jul 2008].

RefSeq NP_000382.3
CDS 62..1753
Misc Feature(1)30
Misc Feature(2)161..580
Misc Feature(3)order(209..211,215..220,224..226,242..247,254..256,
Misc Feature(4)656..1732
Misc Feature(5)725..727
Misc Feature(6)order(875..877,887..889,1031..1042,1130..1132,1136..1141,
Misc Feature(7)order(875..877,887..889,1484..1486)
Misc Feature(8)order(1610..1615,1676..1678,1688..1690)
Exon (1)1..78
Gene:TPP1
Gene Synonym:CLN2; GIG1; LPIC; SCAR7; TPP-1
Exon (2)79..150
Gene:TPP1
Gene Synonym:CLN2; GIG1; LPIC; SCAR7; TPP-1
Exon (3)151..290
Gene:TPP1
Gene Synonym:CLN2; GIG1; LPIC; SCAR7; TPP-1
Exon (4)291..441
Gene:TPP1
Gene Synonym:CLN2; GIG1; LPIC; SCAR7; TPP-1
Exon (5)442..569
Gene:TPP1
Gene Synonym:CLN2; GIG1; LPIC; SCAR7; TPP-1
Exon (6)570..748
Gene:TPP1
Gene Synonym:CLN2; GIG1; LPIC; SCAR7; TPP-1
Exon (7)749..947
Gene:TPP1
Gene Synonym:CLN2; GIG1; LPIC; SCAR7; TPP-1
Exon (8)948..1136
Gene:TPP1
Gene Synonym:CLN2; GIG1; LPIC; SCAR7; TPP-1
Exon (9)1137..1206
Gene:TPP1
Gene Synonym:CLN2; GIG1; LPIC; SCAR7; TPP-1
Exon (10)1207..1327
Gene:TPP1
Gene Synonym:CLN2; GIG1; LPIC; SCAR7; TPP-1
Exon (11)1328..1486
Gene:TPP1
Gene Synonym:CLN2; GIG1; LPIC; SCAR7; TPP-1
Exon (12)1487..1612
Gene:TPP1
Gene Synonym:CLN2; GIG1; LPIC; SCAR7; TPP-1
Exon (13)1613..3533
Gene:TPP1
Gene Synonym:CLN2; GIG1; LPIC; SCAR7; TPP-1
Translation MGLQACLLGLFALILSGKCSYSPEPDQRRTLPPGWVSLGRADPEEELSLTFALRQQNVER LSELVQAVSDPSSPQYGKYLTLENVADLVRPSPLTLHTVQKWLLAAGAQKCHSVITQDFL TCWLSIRQAELLLPGAEFHHYVGGPTETHVVRSPHPYQLPQALAPHVDFVGGLHRFPPTS SLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDL AQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEG QEPFLQWLMLLSNESALPHVHTVSYGDDEDSLSSAYIQRVNTELMKAAARGLTLLFASGD SGAGCWSVSGRHQFRPTFPASSPYVTTVGGTSFQEPFLITNEIVDYISGGGFSNVFPRPS YQEEAVTKFLSSSPHLPPSSYFNASGRAYPDVAALSDGYWVVSNRVPIPWVSGTSASTPV FGGILSLINEHRILSGRPPLGFLNPRLYQQHGAGLFDVTRGCHESCLDEEVEGQGFCSGP GWDPVTGWGTPNFPALLKTLLNP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(10)-dbSNP:
complement(10)-t, gdbSNP:377520438
complement(22)-g, adbSNP:200184958
complement(42)-g, cdbSNP:368143492
complement(44)-t, cdbSNP:371279534
complement(48)-g, adbSNP:377697624
complement(68)-t, gdbSNP:142163063
complement(75)-t, gdbSNP:138976576
complement(103)-dbSNP:
complement(103)-c, adbSNP:35903915
complement(126)-c, adbSNP:202025584
complement(130)-t, cdbSNP:141680923
complement(134)-t, gdbSNP:373323264
complement(144)-t, cdbSNP:369126677
complement(162)-dbSNP:
complement(162)-t, cdbSNP:138448968
complement(203)-t, gdbSNP:201847207
complement(246)-t, cdbSNP:2734715
complement(274)-g, adbSNP:143730817
complement(286)-t, cdbSNP:368709098
complement(289)-g, adbSNP:373318861
290+a, gdbSNP:121908195
complement(317)-dbSNP:
complement(317)-t, cdbSNP:140663603
complement(321)-t, cdbSNP:148064565
complement(335)-g, adbSNP:372102190
complement(354)-g, adbSNP:140726254
complement(355)-t, cdbSNP:141417655
complement(359)-g, adbSNP:201661852
complement(372)-t, adbSNP:202189057
complement(374)-c, adbSNP:368435226
complement(380)-t, cdbSNP:201613668
complement(384)-g, adbSNP:374132017
complement(391)-t, cdbSNP:145853102
complement(397)-t, adbSNP:199539943
441+a, gdbSNP:121908204
complement(496)-dbSNP:
complement(496)-g, adbSNP:188822344
complement(502)-g, adbSNP:2555170
complement(563)-c, adbSNP:370920825
complement(574)-dbSNP:
complement(574)-c, adbSNP:145224171
complement(593)-g, cdbSNP:149986601
complement(603)-g, adbSNP:139059149
complement(614)-t, cdbSNP:34758634
666+c, tdbSNP:121908205
677+c, tdbSNP:28940573
678+a, gdbSNP:121908209
683+c, tdbSNP:119455955
complement(726)-t, cdbSNP:372787642
complement(730..731)-, gdbSNP:143313287
complement(796)-dbSNP:
complement(796)-g, adbSNP:376072689
complement(802)-g, adbSNP:372817942
complement(837)-t, cdbSNP:140176031
complement(843)-g, adbSNP:146136938
complement(857)-g, adbSNP:200138397
complement(864)-t, cdbSNP:141920079
complement(868)-g, adbSNP:148222726
890+a, gdbSNP:121908207
complement(901)-g, cdbSNP:140349036
complement(901)-g, cdbSNP:386466231
912+g, tdbSNP:119455957
918+a, gdbSNP:119455958
921+a, tdbSNP:121908196
complement(924)-t, gdbSNP:201561710
complement(978)-dbSNP:
complement(978)-t, adbSNP:201192562
complement(1008)-t, gdbSNP:149463616
complement(1042)-g, adbSNP:137937009
complement(1043)-g, cdbSNP:202086458
complement(1064)-t, cdbSNP:146927291
1088+a, gdbSNP:121908197
complement(1094)-t, gdbSNP:141482368
complement(1104)-t, gdbSNP:370144405
complement(1105)-t, cdbSNP:35706972
complement(1110)-t, cdbSNP:199866669
1118+a, cdbSNP:121908206
complement(1119)-t, gdbSNP:145966505
complement(1147)-dbSNP:
complement(1147)-t, cdbSNP:140809393
complement(1150)-g, adbSNP:151068181
1154+c, tdbSNP:119455953
1155+a, gdbSNP:119455954
complement(1175)-g, adbSNP:371314926
complement(1178)-g, cdbSNP:112812685
complement(1184)-g, adbSNP:368914445
complement(1199)-t, cdbSNP:190013230
complement(1202)-g, adbSNP:200959385
1215+dbSNP:
1215+a, tdbSNP:121908198
1227+a, gdbSNP:121908199
complement(1252)-g, adbSNP:148950375
complement(1253)-g, adbSNP:149319579
complement(1302)-t, adbSNP:146798796
complement(1313)-g, adbSNP:143584882
complement(1314)-t, cdbSNP:138744051
1327+c, gdbSNP:121908200
complement(1341..1342)-dbSNP:
complement(1341..1342)-, cdbSNP:34736006
complement(1341)-g, adbSNP:201034755
complement(1368)-g, adbSNP:150039898
complement(1389)-t, cdbSNP:139343938
complement(1396)-g, adbSNP:150872335
1401+a, gdbSNP:119455956
1422+a, cdbSNP:121908201
complement(1423)-t, cdbSNP:141701073
complement(1444)-t, cdbSNP:202190396
complement(1457)-t, cdbSNP:78970155
1458+g, tdbSNP:398122959
1478+a, gdbSNP:121908203
1485+c, tdbSNP:121908202
1505+dbSNP:
1505+c, gdbSNP:121908208
complement(1531)-g, cdbSNP:367681647
complement(1550)-g, adbSNP:377700188
complement(1555)-g, adbSNP:117942457
complement(1556)-g, cdbSNP:201126448
complement(1558)-g, adbSNP:142672910
complement(1575)-g, cdbSNP:138941580
complement(1587)-t, cdbSNP:149529997
1603+a, tdbSNP:1128396
complement(1619)-dbSNP:
complement(1619)-t, gdbSNP:371204585
complement(1620)-t, cdbSNP:368697480
complement(1643)-t, cdbSNP:375364589
complement(1675)-g, adbSNP:55684773
1691+c, tdbSNP:121908210
complement(1714)-g, cdbSNP:372564255
complement(1725)-t, gdbSNP:200880556
complement(1765)-t, gdbSNP:368345241
complement(1767)-t, cdbSNP:374983247
complement(1797)-t, adbSNP:370517226
complement(1801)-t, adbSNP:367879648
complement(1824)-t, cdbSNP:140680586
1893+g, tdbSNP:2555171
complement(1940)-t, cdbSNP:12289910
complement(1944..1945)-, gdbSNP:34210291
complement(1994)-g, adbSNP:74843914
complement(2005)-g, adbSNP:111594949
2012+c, tdbSNP:151296958
complement(2065)-g, adbSNP:201122774
complement(2067)-, adbSNP:202155605
complement(2094)-g, adbSNP:142480159
2099+c, tdbSNP:149218047
complement(2185)-t, adbSNP:372993882
complement(2227)-t, adbSNP:145461599
complement(2328)-, adbSNP:34308615
complement(2600..2614)-, aggacttgttgattgdbSNP:146267350
complement(2719)-t, gdbSNP:144157135
complement(2739)-g, cdbSNP:188148381
2781+c, tdbSNP:1802018
complement(2838)-c, adbSNP:374765991
complement(2847)-t, cdbSNP:140414512
2871+c, gdbSNP:1045450
complement(2973)-g, cdbSNP:183015906
complement(2984)-t, cdbSNP:368452233
complement(3003)-t, adbSNP:193029892
3005+a, cdbSNP:1802017
complement(3181)-g, adbSNP:188544089
complement(3228..3229)-tc, aadbSNP:386750286
complement(3230)-t, cdbSNP:147581280
complement(3293)-g, adbSNP:374146578
complement(3323)-t, cdbSNP:369352772
3341+c, tdbSNP:7487
3381+a, gdbSNP:7488
3440+a, gdbSNP:3185635
complement(3443)-t, cdbSNP:377714674
3475+a, cdbSNP:1802019
complement(3503)-c, adbSNP:139164847
Gene SymbolTPP1
Gene SynonymCLN2; GIG1; LPIC; SCAR7; TPP-1
Chromosome11
Locus Map11p15
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000391 Homo sapiens tripeptidyl peptidase I (TPP1), mRNA. On-demand $219.00 7-9
Title Suppression of telomere-binding protein TPP1 resulted in telomere dysfunction and enhanced radiation sensitivity in telomerase-negative osteosarcoma cell line .
Author Qiang W, Wu Q, Zhou F, Xie C, Wu C and Zhou Y.
Journal Biochem. Biophys. Res. Commun. 445 (2), 363-368 (2014)
Title G-quadruplex formation in telomeres enhances POT1/TPP1 protection against RPA binding .
Author Ray S, Bandaria JN, Qureshi MH, Yildiz A and Balci H.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (8), 2990-2995 (2014)
Title A zebrafish model of CLN2 disease is deficient in tripeptidyl peptidase 1 and displays progressive neurodegeneration accompanied by a reduction in proliferation .
Author Mahmood F, Fu S, Cooke J, Wilson SW, Cooper JD and Russell C.
Journal Brain 136 (PT 5), 1488-1507 (2013)
Title Phosphorylation of TPP1 regulates cell cycle-dependent telomerase recruitment .
Author Zhang Y, Chen LY, Han X, Xie W, Kim H, Yang D, Liu D and Songyang Z.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (14), 5457-5462 (2013)
Title The human CLN2 protein/tripeptidyl-peptidase I is a serine protease that autoactivates at acidic pH .
Author Lin L, Sohar I, Lackland H and Lobel P.
Journal J. Biol. Chem. 276 (3), 2249-2255 (2001)
Title Structural organization and sequence of CLN2, the defective gene in classical late infantile neuronal ceroid lipofuscinosis .
Author Liu CG, Sleat DE, Donnelly RJ and Lobel P.
Journal Genomics 50 (2), 206-212 (1998)
Title Association of mutations in a lysosomal protein with classical late-infantile neuronal ceroid lipofuscinosis .
Author Sleat DE, Donnelly RJ, Lackland H, Liu CG, Sohar I, Pullarkat RK and Lobel P.
Journal Science 277 (5333), 1802-1805 (1997)
Title Purification and characterization of a tripeptidyl peptidase I from human osteoclastomas: evidence for its role in bone resorption .
Author Page AE, Fuller K, Chambers TJ and Warburton MJ.
Journal Arch. Biochem. Biophys. 306 (2), 354-359 (1993)
Title Neuronal Ceroid-Lipofuscinoses .
Author Mole,S.E. and Williams,R.E.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Dystonia Overview .
Author Klein,C., Marras,C. and Munchau,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.