Homo sapiens interleukin 2 receptor, alpha (IL2RA), mRNA.
| RefSeq Version | NM_000417.2, 269973860 |
| Length | 3216 bp |
| Structure | linear |
| Update Date | 01-MAY-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens interleukin 2 receptor, alpha (IL2RA), mRNA. |
| Product | interleukin-2 receptor subunit alpha precursor |
| Comment | Summary: The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency.[provided by RefSeq]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. |
| RefSeq | NP_000408.1 |
| CDS | 220..1038 | Exon (1) | 1..283 | Exon (2) | 1..283 | Exon (3) | 284..475 | Exon (4) | 476..586 | Exon (5) | 587..802 | Exon (6) | 803..874 | Exon (7) | 875..946 | Exon (8) | 947..1013 | Exon (9) | 1014..3216 |
| Translation | MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(103) | - | g, a | dbSNP:77523521 |
| 127 | + | g, t | dbSNP:72650659 |
| 131 | + | c, g | dbSNP:74162091 |
| complement(174) | - | t, c | dbSNP:75830636 |
| 264 | + | a, g | dbSNP:74162092 |
| complement(295) | - | g, c | dbSNP:55868253 |
| 303 | + | a, g | dbSNP:2228150 |
| 399 | + | c, t | dbSNP:74162093 |
| complement(459) | - | g, a | dbSNP:41306826 |
| complement(491..492) | - | , a | dbSNP:36065822 |
| 491 | + | c, t | dbSNP:72650666 |
| complement(492) | - | t, c | dbSNP:41290331 |
| complement(551) | - | t, c | dbSNP:56054476 |
| complement(557) | - | c, a | dbSNP:76029930 |
| 566 | + | c, t | dbSNP:74162095 |
| 735 | + | c, t | dbSNP:2228149 |
| complement(746) | - | t, c | dbSNP:55841382 |
| complement(930) | - | t, c | dbSNP:11256354 |
| 948 | + | a, g | dbSNP:74162100 |
| 972 | + | c, t | dbSNP:12722698 |
| complement(975) | - | t, g | dbSNP:113428577 |
| 1034 | + | c, t | dbSNP:12722712 |
| 1093 | + | c, t | dbSNP:12722713 |
| 1108 | + | a, g | dbSNP:12722600 |
| 1145 | + | c, t | dbSNP:12722714 |
| 1361 | + | g, t | dbSNP:12722715 |
| complement(1420..1421) | - | , g | dbSNP:34686279 |
| 1482 | + | a, t | dbSNP:12722601 |
| complement(1620) | - | t, g | dbSNP:56206280 |
| 1715 | + | a, g | dbSNP:12719919 |
| complement(1744) | - | c, a | dbSNP:76471890 |
| complement(1745) | - | g, c | dbSNP:75779793 |
| complement(1747) | - | t, g | dbSNP:76242406 |
| complement(1790) | - | t, c | dbSNP:41290329 |
| 1926 | + | c, t | dbSNP:12722716 |
| 1991 | + | a, g | dbSNP:12722717 |
| 2007 | + | a, g | dbSNP:12722602 |
| 2046 | + | a, g | dbSNP:34164172 |
| 2062 | + | a, g | dbSNP:12722718 |
| 2064 | + | a, g | dbSNP:28360484 |
| complement(2099) | - | g, a | dbSNP:55885853 |
| 2224 | + | c, t | dbSNP:12722603 |
| complement(2299) | - | t, a | dbSNP:115247277 |
| complement(2305) | - | t, c | dbSNP:1570538 |
| 2381 | + | a, c | dbSNP:12722719 |
| complement(2499) | - | g, a | dbSNP:12244380 |
| 2573 | + | , tg | dbSNP:71390108 |
| 2587 | + | c, t | dbSNP:12722604 |
| 2710 | + | a, t | dbSNP:12722605 |
| 2740 | + | c, t | dbSNP:12722606 |
| complement(2810) | - | t, g | dbSNP:74973937 |
| complement(2820) | - | c, a | dbSNP:77249340 |
| complement(2824) | - | g, a | dbSNP:74568864 |
| 2918 | + | c, g | dbSNP:12722607 |
| 3012 | + | c, t | dbSNP:12722720 |
| 3032 | + | g, t | dbSNP:12722608 |
| complement(3146) | - | c, a | dbSNP:74895246 |
| Gene Symbol | IL2RA |
| Gene Synonym | CD25; IDDM10; IL2R; TCGFR |
| Chromosome | 10 |
| Locus Map | 10p15-p14 |
| All Transcripts | NM_000417 |
| Title | Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph . |
| Author | Casabonne,D., Reina,O., Benavente,Y., Becker,N., Maynadie,M., Foretova,L., Cocco,P., Gonzalez-Neira,A., Nieters,A., Boffetta,P., Middeldorp,J.M. and de Sanjose,S. |
| Journal | Haematologica 96 (2), 323-327 (2011) |
| Title | The vitamin D analog, TX527, promotes a human CD4+CD25highCD127low regulatory T cell profile and induces a migratory signature specific for homing to sites of inflammation . |
| Author | Baeke,F., Korf,H., Overbergh,L., Verstuyf,A., Thorrez,L., Van Lommel,L., Waer,M., Schuit,F., Gysemans,C. and Mathieu,C. |
| Journal | J. Immunol. 186 (1), 132-142 (2011) |
| Title | Clinical relevance of elevated levels of serum soluble interleukin-2 receptor alpha (sIL-2Ralpha) in patients with non-Hodgkin's lymphoma . |
| Author | Jo,S.A., Hwang,S.H., Chang,C.L., Kim,S.Y., Shin,H.J., Chung,J.S., Sol,M.Y. and Lee,E.Y. |
| Journal | Korean J Lab Med 30 (6), 600-605 (2010) |
| Title | Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci . |
| Author | Franke,A., McGovern,D.P., Barrett,J.C., Wang,K., Radford-Smith,G.L., Ahmad,T., Lees,C.W., Balschun,T., Lee,J., Roberts,R., Anderson,C.A., Bis,J.C., Bumpstead,S., Ellinghaus,D., Festen,E.M., Georges,M., Green,T., Haritunians,T., Jostins,L., Latiano,A., Mathew,C.G., Montgomery,G.W., Prescott,N.J., Raychaudhuri,S., Rotter,J.I., Schumm,P., Sharma,Y., Simms,L.A., Taylor,K.D., Whiteman,D., Wijmenga,C., Baldassano,R.N., Barclay,M., Bayless,T.M., Brand,S., Buning,C., Cohen,A., Colombel,J.F., Cottone,M., Stronati,L., Denson,T., De Vos,M., D'Inca,R., Dubinsky,M., Edwards,C., Florin,T., Franchimont,D., Gearry,R., Glas,J., Van Gossum,A., Guthery,S.L., Halfvarson,J., Verspaget,H.W., Hugot,J.P., Karban,A., Laukens,D., Lawrance,I., Lemann,M., Levine,A., Libioulle,C., Louis,E., Mowat,C., Newman,W., Panes,J., Phillips,A., Proctor,D.D., Regueiro,M., Russell,R., Rutgeerts,P., Sanderson,J., Sans,M., Seibold,F., Steinhart,A.H., Stokkers,P.C., Torkvist,L., Kullak-Ublick,G., Wilson,D., Walters,T., Targan,S.R., Brant,S.R., Rioux,J.D., D'Amato,M., Weersma,R.K., Kugathasan,S., Griffiths,A.M., Mansfield,J.C., Vermeire,S., Duerr,R.H., Silverberg,M.S., Satsangi,J., Schreiber,S., Cho,J.H., Annese,V., Hakonarson,H., Daly,M.J. and Parkes,M. |
| Journal | Nat. Genet. 42 (12), 1118-1125 (2010) |
| Title | Stem cell factor, interleukin-16, and interleukin-2 receptor alpha are predictive biomarkers for delayed and slow graft function . |
| Author | Alachkar,N., Ugarte,R., Huang,E., Womer,K.L., Montgomery,R., Kraus,E. and Rabb,H. |
| Journal | Transplant. Proc. 42 (9), 3399-3405 (2010) |
| Title | Suppression of interleukin-2 and interleukin-2 receptor expression in Jurkat cells stably expressing the human immunodeficiency virus Tat protein . |
| Author | Purvis,S.F., Georges,D.L., Williams,T.M. and Lederman,M.M. |
| Journal | Cell. Immunol. 144 (1), 32-42 (1992) |
| Title | The augmentation of lymphokine-activated killer activity following pulsing of human peripheral blood mononuclear cells with recombinant human interleukin-2 . |
| Author | Carter,C.R., Hancock,B.W. and Rees,R.C. |
| Journal | Cancer Immunol. Immunother. 35 (4), 264-270 (1992) |
| Title | A novel subpopulation of CD45RA+ CD4+ T cells expressing IL-2 receptor alpha-chain (CD25) and having a functionally transitional nature into memory cells . |
| Author | Kanegane,H., Miyawaki,T., Kato,K., Yokoi,T., Uehara,T., Yachie,A. and Taniguchi,N. |
| Journal | Int. Immunol. 3 (12), 1349-1356 (1991) |
| Title | Association of intercellular adhesion molecule 1 with the multichain high-affinity interleukin 2 receptor . |
| Author | Burton,J., Goldman,C.K., Rao,P., Moos,M. and Waldmann,T.A. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 87 (18), 7329-7333 (1990) |
| Title | Interleukin-2 and the IL-2 receptor: new insights into structure and function . |
| Author | Kuziel,W.A. and Greene,W.C. |
| Journal | J. Invest. Dermatol. 94 (6 SUPPL), 27S-32S (1990) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |