• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 2 receptor, alpha (IL2RA), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21222 Homo sapiens interleukin 2 receptor, alpha (IL2RA), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu21222C Homo sapiens interleukin 2 receptor, alpha (IL2RA), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000417.2, 269973860
Length 819 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 2 receptor, alpha (IL2RA), mRNA.
Product interleukin-2 receptor subunit alpha precursor
Comment

Summary: The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency.[provided by RefSeq, Nov 2009].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000408.1
CDS 220..1038
Misc Feature(1)148..150
Misc Feature(2)order(289..291,418..420)
Misc Feature(3)295..453
Misc Feature(4)order(364..366,457..459)
Misc Feature(5)order(370..372,463..465)
Misc Feature(6)592..771
Misc Feature(7)order(592..594,721..723)
Misc Feature(8)order(619..621,676..678)
Misc Feature(9)order(673..675,769..771)
Misc Feature(10)940..996
Misc Feature(11)1021..1023
Misc Feature(12)1030..1032
Exon (1)1..283
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (2)284..475
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (3)476..586
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (4)587..802
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (5)803..874
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (6)875..946
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (7)947..1013
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (8)1014..3216
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Translation MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
127+dbSNP:
127+g, tdbSNP:72650659
131+c, gdbSNP:74162091
complement(174)-t, cdbSNP:75830636
complement(201)-c, adbSNP:144690178
264+a, gdbSNP:74162092
complement(283)-t, cdbSNP:267602536
complement(292)-dbSNP:
complement(292)-t, cdbSNP:201995749
complement(295)-g, cdbSNP:55868253
complement(303)-g, adbSNP:2228150
complement(305)-g, adbSNP:148505161
complement(310)-t, gdbSNP:372125213
complement(336)-t, cdbSNP:146345652
complement(344)-t, cdbSNP:142016545
399+c, tdbSNP:74162093
complement(400)-t, cdbSNP:201617475
complement(412)-t, cdbSNP:372359952
complement(444)-g, adbSNP:372481445
complement(459)-g, adbSNP:41306826
complement(482)-dbSNP:
complement(482)-g, cdbSNP:139340259
complement(491..492)-, adbSNP:36065822
complement(491)-t, cdbSNP:72650666
complement(492)-t, cdbSNP:41290331
complement(516)-t, adbSNP:201105599
complement(519)-t, cdbSNP:200838485
complement(551)-t, cdbSNP:56054476
complement(557)-c, adbSNP:76029930
complement(561)-t, cdbSNP:376596128
566+c, tdbSNP:74162095
complement(575)-g, adbSNP:138645280
complement(576)-t, cdbSNP:150164762
complement(640)-dbSNP:
complement(640)-g, adbSNP:267602533
complement(644)-, adbSNP:373429536
complement(655)-t, gdbSNP:141655051
complement(658)-t, adbSNP:147975326
complement(675)-g, adbSNP:377104035
complement(676)-t, cdbSNP:201188114
complement(703)-t, cdbSNP:146966522
complement(704)-t, cdbSNP:141246728
complement(718)-t, cdbSNP:147791171
complement(733)-g, adbSNP:372508950
735+c, tdbSNP:2228149
complement(746)-t, cdbSNP:55841382
complement(776)-t, cdbSNP:368304698
complement(781)-t, cdbSNP:149181289
complement(798)-t, adbSNP:376008631
complement(829)-dbSNP:
complement(829)-t, cdbSNP:370516220
complement(843)-g, cdbSNP:367926771
complement(862)-t, cdbSNP:145428184
complement(870)-t, cdbSNP:373337461
complement(910)-dbSNP:
complement(910)-g, cdbSNP:150060415
complement(912)-t, cdbSNP:139266750
complement(916)-g, adbSNP:201522266
complement(919)-t, cdbSNP:375756091
complement(930)-t, cdbSNP:11256354
complement(936)-t, gdbSNP:138764230
948+dbSNP:
948+a, gdbSNP:74162100
complement(972)-t, cdbSNP:12722698
complement(975)-t, gdbSNP:113428577
complement(976)-t, cdbSNP:143550766
complement(1006)-g, adbSNP:140088691
complement(1034)-t, cdbSNP:12722712
complement(1034)-g, adbSNP:386525829
complement(1074)-g, adbSNP:372312640
1093+c, tdbSNP:12722713
1108+a, gdbSNP:12722600
complement(1145)-t, cdbSNP:12722714
complement(1243)-g, adbSNP:367718232
complement(1312)-t, cdbSNP:185829590
1361+g, tdbSNP:12722715
complement(1420..1421)-, gdbSNP:34686279
1482+a, tdbSNP:12722601
complement(1499)-g, cdbSNP:181357994
complement(1516)-g, cdbSNP:188613092
complement(1620)-t, gdbSNP:56206280
1715+a, gdbSNP:12719919
complement(1744)-c, adbSNP:76471890
complement(1745)-g, cdbSNP:75779793
complement(1747)-t, gdbSNP:76242406
complement(1790)-t, cdbSNP:41290329
complement(1805)-g, adbSNP:143416542
1926+c, tdbSNP:12722716
complement(1927)-t, cdbSNP:147669116
1991+a, gdbSNP:12722717
complement(1991)-g, adbSNP:386525830
2007+a, gdbSNP:12722602
2046+a, gdbSNP:34164172
complement(2046)-g, adbSNP:386454142
2062+a, gdbSNP:12722718
2064+a, gdbSNP:28360484
complement(2079)-g, adbSNP:141524746
complement(2099)-g, adbSNP:55885853
complement(2107)-g, adbSNP:149796519
complement(2123)-t, cdbSNP:374118462
complement(2224)-t, cdbSNP:12722603
complement(2224)-t, cdbSNP:386525825
complement(2272)-g, adbSNP:370765858
complement(2299)-t, adbSNP:115247277
complement(2305)-t, cdbSNP:1570538
complement(2362)-c, adbSNP:151183621
2381+a, cdbSNP:12722719
complement(2466)-t, cdbSNP:143496123
complement(2499)-g, adbSNP:12244380
2572..2573+, tgdbSNP:71390108
complement(2575..2576)-, acdbSNP:148885460
2587+c, tdbSNP:12722604
complement(2687)-g, adbSNP:184686521
2710+a, tdbSNP:12722605
2740+c, tdbSNP:12722606
complement(2810)-t, gdbSNP:74973937
2918+c, gdbSNP:12722607
3012+c, tdbSNP:12722720
complement(3032)-t, gdbSNP:386525826
3032+g, tdbSNP:12722608
complement(3040)-g, cdbSNP:192145132
complement(3146)-c, adbSNP:74895246
Gene SymbolIL2RA
Gene SynonymCD25; IDDM10; IL2R; TCGFR
Chromosome10
Locus Map10p15-p14
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000417 Homo sapiens interleukin 2 receptor, alpha (IL2RA), mRNA. In-stock $99.00 5-7
NM_000417 Homo sapiens interleukin 2 receptor, alpha (IL2RA), mRNA. In-stock $99.00 5-7
Title HIV infection deregulates the balance between regulatory T cells and IL-2-producing CD4 T cells by decreasing the expression of the IL-2 receptor in Treg .
Author Mendez-Lagares G, Jaramillo-Ruiz D, Pion M, Leal M, Munoz-Fernandez MA, Pacheco YM and Correa-Rocha R.
Journal J. Acquir. Immune Defic. Syndr. 65 (3), 278-282 (2014)
Title Novel rheumatoid arthritis susceptibility locus at 22q12 identified in an extended UK genome-wide association study .
Author Orozco G, Viatte S, Bowes J, Martin P, Wilson AG, Morgan AW, Steer S, Wordsworth P, Hocking LJ, Barton A, Worthington J and Eyre S.
Journal Arthritis Rheumatol 66 (1), 24-30 (2014)
Title IL-21 signalling via STAT3 primes human naive B cells to respond to IL-2 to enhance their differentiation into plasmablasts .
Author Berglund LJ, Avery DT, Ma CS, Moens L, Deenick EK, Bustamante J, Boisson-Dupuis S, Wong M, Adelstein S, Arkwright PD, Bacchetta R, Bezrodnik L, Dadi H, Roifman CM, Fulcher DA, Ziegler JB, Smart JM, Kobayashi M, Picard C, Durandy A, Cook MC, Casanova JL, Uzel G and Tangye SG.
Journal Blood 122 (24), 3940-3950 (2013)
Title MicroRNA-directed program of cytotoxic CD8+ T-cell differentiation .
Author Trifari S, Pipkin ME, Bandukwala HS, Aijo T, Bassein J, Chen R, Martinez GJ and Rao A.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (46), 18608-18613 (2013)
Title Insulin-dependent diabetes induced by pancreatic beta cell expression of IL-15 and IL-15Ralpha .
Author Chen J, Feigenbaum L, Awasthi P, Butcher DO, Anver MR, Golubeva YG, Bamford R, Zhang X, St Claire MB, Thomas CJ, Discepolo V, Jabri B and Waldmann TA.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (33), 13534-13539 (2013)
Title Suppression of interleukin-2 and interleukin-2 receptor expression in Jurkat cells stably expressing the human immunodeficiency virus Tat protein .
Author Purvis SF, Georges DL, Williams TM and Lederman MM.
Journal Cell. Immunol. 144 (1), 32-42 (1992)
Title The augmentation of lymphokine-activated killer activity following pulsing of human peripheral blood mononuclear cells with recombinant human interleukin-2 .
Author Carter CR, Hancock BW and Rees RC.
Journal Cancer Immunol. Immunother. 35 (4), 264-270 (1992)
Title A novel subpopulation of CD45RA+ CD4+ T cells expressing IL-2 receptor alpha-chain (CD25) and having a functionally transitional nature into memory cells .
Author Kanegane H, Miyawaki T, Kato K, Yokoi T, Uehara T, Yachie A and Taniguchi N.
Journal Int. Immunol. 3 (12), 1349-1356 (1991)
Title Association of intercellular adhesion molecule 1 with the multichain high-affinity interleukin 2 receptor .
Author Burton J, Goldman CK, Rao P, Moos M and Waldmann TA.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (18), 7329-7333 (1990)
Title Interleukin-2 and the IL-2 receptor: new insights into structure and function .
Author Kuziel WA and Greene WC.
Journal J. Invest. Dermatol. 94 (6 SUPPL), 27S-32S (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.