• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 2 receptor, alpha (IL2RA), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000417 Homo sapiens interleukin 2 receptor, alpha (IL2RA), mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_000417.2, 269973860
Length 3216 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 2 receptor, alpha (IL2RA), mRNA.
Product interleukin-2 receptor subunit alpha precursor
Comment

Summary: The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency.[provided by RefSeq, Nov 2009].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000408.1
CDS 220..1038
Misc Feature(1)148..150
Misc Feature(2)order(289..291,418..420)
Misc Feature(3)295..453
Misc Feature(4)order(364..366,457..459)
Misc Feature(5)order(370..372,463..465)
Misc Feature(6)592..771
Misc Feature(7)order(592..594,721..723)
Misc Feature(8)order(619..621,676..678)
Misc Feature(9)order(673..675,769..771)
Misc Feature(10)940..996
Misc Feature(11)1021..1023
Misc Feature(12)1030..1032
Exon (1)1..283
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (2)284..475
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (3)476..586
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (4)587..802
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (5)803..874
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (6)875..946
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (7)947..1013
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Exon (8)1014..3216
Gene:IL2RA
Gene Synonym:CD25; IDDM10; IL2R; TCGFR
Translation MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(127)-dbSNP:
complement(127)-t, gdbSNP:72650659
complement(131)-g, cdbSNP:74162091
complement(174)-t, cdbSNP:75830636
complement(201)-c, adbSNP:144690178
complement(264)-g, adbSNP:74162092
complement(292)-dbSNP:
complement(292)-t, cdbSNP:201995749
complement(295)-g, cdbSNP:55868253
complement(303)-g, adbSNP:2228150
complement(305)-g, adbSNP:148505161
complement(336)-t, cdbSNP:146345652
complement(344)-t, cdbSNP:142016545
complement(399)-t, cdbSNP:74162093
complement(400)-t, cdbSNP:201617475
complement(459)-g, adbSNP:41306826
complement(482)-dbSNP:
complement(482)-g, cdbSNP:139340259
complement(491..492)-, adbSNP:36065822
complement(491)-t, cdbSNP:72650666
complement(492)-t, cdbSNP:41290331
complement(516)-t, adbSNP:201105599
complement(519)-t, cdbSNP:200838485
complement(551)-t, cdbSNP:56054476
complement(557)-c, adbSNP:76029930
complement(566)-t, cdbSNP:74162095
complement(575)-g, adbSNP:138645280
complement(576)-t, cdbSNP:150164762
complement(655)-dbSNP:
complement(655)-t, gdbSNP:141655051
complement(658)-t, adbSNP:147975326
complement(676)-t, cdbSNP:201188114
complement(703)-t, cdbSNP:146966522
complement(704)-t, cdbSNP:141246728
complement(718)-t, cdbSNP:147791171
complement(735)-t, cdbSNP:2228149
complement(746)-t, cdbSNP:55841382
complement(781)-t, cdbSNP:149181289
complement(862)-dbSNP:
complement(862)-t, cdbSNP:145428184
complement(910)-dbSNP:
complement(910)-g, cdbSNP:150060415
complement(912)-t, cdbSNP:139266750
complement(916)-g, adbSNP:201522266
complement(930)-t, cdbSNP:11256354
complement(936)-t, gdbSNP:138764230
complement(948)-dbSNP:
complement(948)-g, adbSNP:74162100
complement(972)-t, cdbSNP:12722698
complement(975)-t, gdbSNP:113428577
complement(976)-t, cdbSNP:143550766
complement(1006)-g, adbSNP:140088691
complement(1034)-t, cdbSNP:12722712
complement(1093)-t, cdbSNP:12722713
complement(1108)-g, adbSNP:12722600
complement(1145)-t, cdbSNP:12722714
complement(1312)-t, cdbSNP:185829590
complement(1361)-t, gdbSNP:12722715
complement(1422..1423)-, gdbSNP:34686279
complement(1482)-t, adbSNP:12722601
complement(1499)-g, cdbSNP:181357994
complement(1516)-g, cdbSNP:188613092
complement(1620)-t, gdbSNP:56206280
complement(1715)-g, adbSNP:12719919
complement(1744)-c, adbSNP:76471890
complement(1745)-g, cdbSNP:75779793
complement(1747)-t, gdbSNP:76242406
complement(1790)-t, cdbSNP:41290329
complement(1805)-g, adbSNP:143416542
complement(1926)-t, cdbSNP:12722716
complement(1927)-t, cdbSNP:147669116
complement(1991)-g, adbSNP:12722717
complement(2007)-g, adbSNP:12722602
complement(2046)-g, adbSNP:34164172
complement(2062)-g, adbSNP:12722718
complement(2064)-g, adbSNP:28360484
complement(2079)-g, adbSNP:141524746
complement(2099)-g, adbSNP:55885853
complement(2107)-g, adbSNP:149796519
complement(2224)-t, cdbSNP:12722603
complement(2299)-t, adbSNP:115247277
complement(2305)-t, cdbSNP:1570538
complement(2362)-c, adbSNP:151183621
complement(2381)-c, adbSNP:12722719
complement(2466)-t, cdbSNP:143496123
complement(2499)-g, adbSNP:12244380
complement(2575..2576)-, acdbSNP:148885460
complement(2575)-, tgdbSNP:71390108
complement(2587)-t, cdbSNP:12722604
complement(2687)-g, adbSNP:184686521
complement(2710)-t, adbSNP:12722605
complement(2740)-t, cdbSNP:12722606
complement(2810)-t, gdbSNP:74973937
complement(2918)-g, cdbSNP:12722607
complement(3012)-t, cdbSNP:12722720
complement(3032)-t, gdbSNP:12722608
complement(3040)-g, cdbSNP:192145132
complement(3146)-c, adbSNP:74895246
Gene SymbolIL2RA
Gene SynonymCD25; IDDM10; IL2R; TCGFR
Chromosome10
Locus Map10p15-p14
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000417 Homo sapiens interleukin 2 receptor, alpha (IL2RA), mRNA. In-stock $348.00 $299.00 10
Title Human IL2RA null mutation mediates immunodeficiency with lymphoproliferation and autoimmunity .
Author Goudy,K., Aydin,D., Barzaghi,F., Gambineri,E., Vignoli,M., Ciullini Mannurita,S., Doglioni,C., Ponzoni,M., Cicalese,M.P., Assanelli,A., Tommasini,A., Brigida,I., Dellepiane,R.M., Martino,S., Olek,S., Aiuti,A., Ciceri,F., Roncarolo,M.G. and Bacchetta,R.
Journal Clin. Immunol. 146 (3), 248-261 (2013)
Title The protein pheromone Er-1 of the ciliate Euplotes raikovi stimulates human T-cell activity: involvement of interleukin-2 system .
Author Cervia,D., Catalani,E., Belardinelli,M.C., Perrotta,C., Picchietti,S., Alimenti,C., Casini,G., Fausto,A.M. and Vallesi,A.
Journal Exp. Cell Res. 319 (3), 56-67 (2013)
Title Expression of CD25 independently predicts early treatment failure of acute myeloid leukaemia (AML) .
Author Cerny,J., Yu,H., Ramanathan,M., Raffel,G.D., Walsh,W.V., Fortier,N., Shanahan,L., O'Rourke,E., Bednarik,J., Barton,B., Kroll-Desrosiers,A., Hao,S., Woda,B., Hutchinson,L., Evens,A.M., Rosmarin,A.G. and Nath,R.
Journal Br. J. Haematol. 160 (2), 262-266 (2013)
Title IL-7 abrogates suppressive activity of human CD4+CD25+FOXP3+ regulatory T cells and allows expansion of alloreactive and autoreactive T cells .
Author Heninger,A.K., Theil,A., Wilhelm,C., Petzold,C., Huebel,N., Kretschmer,K., Bonifacio,E. and Monti,P.
Journal J. Immunol. 189 (12), 5649-5658 (2012)
Title Chronic immune activation in common variable immunodeficiency (CVID) is associated with elevated serum levels of soluble CD14 and CD25 but not endotoxaemia .
Author Litzman,J., Nechvatalova,J., Xu,J., Ticha,O., Vlkova,M. and Hel,Z.
Journal Clin. Exp. Immunol. 170 (3), 321-332 (2012)
Title Suppression of interleukin-2 and interleukin-2 receptor expression in Jurkat cells stably expressing the human immunodeficiency virus Tat protein .
Author Purvis,S.F., Georges,D.L., Williams,T.M. and Lederman,M.M.
Journal Cell. Immunol. 144 (1), 32-42 (1992)
Title The augmentation of lymphokine-activated killer activity following pulsing of human peripheral blood mononuclear cells with recombinant human interleukin-2 .
Author Carter,C.R., Hancock,B.W. and Rees,R.C.
Journal Cancer Immunol. Immunother. 35 (4), 264-270 (1992)
Title A novel subpopulation of CD45RA+ CD4+ T cells expressing IL-2 receptor alpha-chain (CD25) and having a functionally transitional nature into memory cells .
Author Kanegane,H., Miyawaki,T., Kato,K., Yokoi,T., Uehara,T., Yachie,A. and Taniguchi,N.
Journal Int. Immunol. 3 (12), 1349-1356 (1991)
Title Association of intercellular adhesion molecule 1 with the multichain high-affinity interleukin 2 receptor .
Author Burton,J., Goldman,C.K., Rao,P., Moos,M. and Waldmann,T.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (18), 7329-7333 (1990)
Title Interleukin-2 and the IL-2 receptor: new insights into structure and function .
Author Kuziel,W.A. and Greene,W.C.
Journal J. Invest. Dermatol. 94 (6 SUPPL), 27S-32S (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.