• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 10 (KRT10), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19931 Homo sapiens keratin 10 (KRT10), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu19931C Homo sapiens keratin 10 (KRT10), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000421.3, 195972865
Length 1755 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens keratin 10 (KRT10), mRNA.
Product keratin, type I cytoskeletal 10
Comment

Summary: This gene encodes a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in this gene are associated with epidermolytic hyperkeratosis. This gene is located within a cluster of keratin family members on chromosome 17q21. [provided by RefSeq, Jul 2008].

RefSeq NP_000412.3
CDS 27..1781
Misc Feature(1)27..461
Misc Feature(2)27..461
Misc Feature(3)72..74
Misc Feature(4)150..152
Misc Feature(5)459..1388
Misc Feature(6)462..1394
Misc Feature(7)462..569
Misc Feature(8)570..632
Misc Feature(9)633..908
Misc Feature(10)909..977
Misc Feature(11)978..1394
Misc Feature(12)1395..1778
Exon (1)1..653
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (2)654..736
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (3)737..893
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (4)894..1055
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (5)1056..1181
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (6)1182..1399
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (7)1400..1774
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (8)1775..2140
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Translation MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRG SSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSFGGG GFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKE WYEKHGNSHQGEPRDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYEN EVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTG DVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISS YKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQ IRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGG GSSGGGHGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGG GYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(25)-dbSNP:
complement(25)-g, adbSNP:372303962
complement(37)-t, cdbSNP:142158041
complement(70)-t, cdbSNP:28411890
complement(73)-t, cdbSNP:146957992
complement(96..98)-, tccdbSNP:148510452
complement(123)-t, adbSNP:141187850
complement(124)-g, adbSNP:151149062
complement(151)-g, adbSNP:142050024
complement(155)-g, adbSNP:149227921
complement(156)-g, cdbSNP:145403476
complement(161)-t, cdbSNP:150048434
complement(179)-c, adbSNP:151143129
complement(184)-t, cdbSNP:146835683
complement(188)-t, adbSNP:200567513
complement(202)-t, cdbSNP:374581207
complement(248)-g, adbSNP:201089561
complement(283)-t, cdbSNP:117610737
complement(328)-g, c, adbSNP:4261597
complement(331)-g, adbSNP:114467326
complement(338)-t, cdbSNP:141830953
complement(341)-t, gdbSNP:373769724
complement(364)-t, cdbSNP:371456379
complement(365)-g, adbSNP:144138576
complement(390)-g, adbSNP:201879590
complement(397)-c, adbSNP:200060640
complement(399)-t, cdbSNP:267604859
complement(401)-g, adbSNP:71371451
complement(402)-t, cdbSNP:386476301
431+c, tdbSNP:1132252
440+c, tdbSNP:1132253
443+c, tdbSNP:1132254
complement(456)-t, cdbSNP:146976249
475+c, g, tdbSNP:58901407
483+c, gdbSNP:61460100
486+a, cdbSNP:57784225
491..492+aa, ccdbSNP:60712939
492+a, c, g, tdbSNP:58852768
493+a, c, g, tdbSNP:58075662
495+c, tdbSNP:1132255
498+c, gdbSNP:59175042
500+c, tdbSNP:1132256
504+g, tdbSNP:58414354
505+a, cdbSNP:58735429
507..512+, ttggacdbSNP:56809156
507+c, tdbSNP:1132257
508+c, tdbSNP:60118264
complement(540)-g, adbSNP:376239738
567+c, tdbSNP:1132258
592+a, gdbSNP:1132259
complement(596)-t, cdbSNP:200118465
complement(600)-t, cdbSNP:142767279
complement(607)-t, cdbSNP:373319671
complement(617)-g, adbSNP:200665804
complement(670)-g, cdbSNP:375333087
671+a, tdbSNP:1132260
complement(677)-g, adbSNP:138435395
complement(679)-g, adbSNP:200239146
complement(711)-g, adbSNP:371503347
complement(719)-c, adbSNP:368893029
complement(760)-dbSNP:
complement(760)-t, cdbSNP:369473843
complement(764)-t, cdbSNP:373213430
complement(767)-g, adbSNP:185881153
complement(768)-t, cdbSNP:201691005
complement(782)-g, adbSNP:150098320
complement(815)-g, adbSNP:140700628
827+c, tdbSNP:1132262
833+a, gdbSNP:1132263
complement(834)-t, cdbSNP:373366688
complement(840)-t, gdbSNP:201788518
complement(862)-t, cdbSNP:200397191
complement(869)-g, adbSNP:201038946
complement(874)-t, adbSNP:201886561
complement(883)-t, gdbSNP:61735162
complement(885)-g, adbSNP:150918499
886+a, gdbSNP:1132264
903+dbSNP:
903+c, gdbSNP:1132265
923+c, tdbSNP:1132266
complement(932)-c, adbSNP:145899611
complement(1026)-t, gdbSNP:371899202
complement(1030)-t, cdbSNP:200563139
complement(1032)-t, cdbSNP:140697702
complement(1106)-dbSNP:
complement(1106)-g, adbSNP:368573436
complement(1121)-c, adbSNP:375113624
complement(1166)-g, cdbSNP:146855016
complement(1178)-g, cdbSNP:371654347
complement(1222)-dbSNP:
complement(1222)-t, cdbSNP:370955521
complement(1229)-g, adbSNP:368784181
complement(1254)-g, cdbSNP:143780054
complement(1271)-t, cdbSNP:140096582
1284+c, gdbSNP:1132268
1290..1291+cg, gadbSNP:59075499
1307..1308+aa, ccdbSNP:267607377
1307+a, cdbSNP:387906640
1326+c, tdbSNP:60035576
1340..1341+, cdbSNP:267607379
1341+a, gdbSNP:61434181
1351+a, tdbSNP:58026994
complement(1353)-t, cdbSNP:375567467
1359+a, gdbSNP:267607380
1363+c, tdbSNP:62651994
1366+a, cdbSNP:267607378
1372+a, gdbSNP:267607383
complement(1374)-g, adbSNP:370667058
1377+a, gdbSNP:1132269
1381+c, tdbSNP:62651995
1384+c, tdbSNP:62652043
complement(1394)-g, cdbSNP:373723131
complement(1419)-dbSNP:
complement(1419)-t, cdbSNP:201994123
complement(1444)-t, gdbSNP:201343749
1476..1477+, cdbSNP:267607382
complement(1485)-g, adbSNP:17855579
1572..1577+ggaagc, tdbSNP:267607385
complement(1581)-t, cdbSNP:199819272
1586..1587+, cgdbSNP:267607384
complement(1605)-t, cdbSNP:201576759
complement(1623)-t, cdbSNP:184159044
complement(1655)-g, cdbSNP:370288912
complement(1658)-t, gdbSNP:368733857
complement(1705..1706)-, cccdbSNP:376206308
complement(1735)-g, cdbSNP:112018671
complement(1750)-c, adbSNP:199785115
complement(1765)-t, cdbSNP:372831544
complement(1776)-dbSNP:
complement(1776)-g, adbSNP:199646609
complement(1788)-g, adbSNP:79174420
complement(1821)-t, cdbSNP:373917637
complement(1823)-g, adbSNP:71371449
complement(1844)-g, adbSNP:372649886
1846+a, gdbSNP:12231
complement(1875)-g, adbSNP:117588718
complement(1897)-g, adbSNP:1132367
complement(1907)-g, cdbSNP:141815199
complement(1909)-g, adbSNP:111849607
complement(1928)-t, gdbSNP:112791986
complement(1962)-t, cdbSNP:201389981
complement(2036)-g, adbSNP:192578662
complement(2092)-g, adbSNP:112000562
Gene SymbolKRT10
Gene SynonymBCIE; BIE; CK10; EHK; K10; KPP
Chromosome17
Locus Map17q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000421 Homo sapiens keratin 10 (KRT10), mRNA. On-demand TBD TBD
NM_000421 Homo sapiens keratin 10 (KRT10), mRNA. On-demand TBD TBD
Title PTEN overexpression improves cisplatin-resistance of human ovarian cancer cells through upregulating KRT10 expression .
Author Wu H, Wang K, Liu W and Hao Q.
Journal Biochem. Biophys. Res. Commun. 444 (2), 141-146 (2014)
Title Epidemiology and clinical characteristics of bullous congenital ichthyosiform erythroderma (keratinolytic ichthyosis) in Japan: results from a nationwide survey .
Author Kurosawa M, Takagi A, Tamakoshi A, Kawamura T, Inaba Y, Yokoyama K, Kitajima Y, Aoyama Y, Iwatsuki K and Ikeda S.
Journal J. Am. Acad. Dermatol. 68 (2), 278-283 (2013)
Title Keratin 10-positive orthokeratotic dysplasia: a new leucoplakia-type precancerous entity of the oral mucosa .
Author Kobayashi T, Maruyama S, Abe T, Cheng J, Takagi R, Saito C and Saku T.
Journal Histopathology 61 (5), 910-920 (2012)
Title Molecular mimicry between HSP 65 of Mycobacterium leprae and cytokeratin 10 of the host keratin; role in pathogenesis of leprosy .
Author Singh I, Yadav AR, Mohanty KK, Katoch K, Bisht D, Sharma P, Sharma B, Gupta UD and Sengupta U.
Journal Cell. Immunol. 278 (1-2), 63-75 (2012)
Title Cellular senescence increases expression of bacterial ligands in the lungs and is positively correlated with increased susceptibility to pneumococcal pneumonia .
Author Shivshankar P, Boyd AR, Le Saux CJ, Yeh IT and Orihuela CJ.
Journal Aging Cell 10 (5), 798-806 (2011)
Title Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes .
Author Rasmussen HH, van Damme J, Puype M, Gesser B, Celis JE and Vandekerckhove J.
Journal Electrophoresis 13 (12), 960-969 (1992)
Title The genetic basis of epidermolytic hyperkeratosis: a disorder of differentiation-specific epidermal keratin genes .
Author Cheng J, Syder AJ, Yu QC, Letai A, Paller AS and Fuchs E.
Journal Cell 70 (5), 811-819 (1992)
Title Mutations in the rod domains of keratins 1 and 10 in epidermolytic hyperkeratosis .
Author Rothnagel JA, Dominey AM, Dempsey LD, Longley MA, Greenhalgh DA, Gagne TA, Huber M, Frenk E, Hohl D and Roop DR.
Journal Science 257 (5073), 1128-1130 (1992)
Title Exons I and VII of the gene (Ker10) encoding human keratin 10 undergo structural rearrangements within repeats .
Author Tkachenko AV, Buchman VL, Bliskovsky VV, Shvets YuP and Kisselev LL.
Journal Gene 116 (2), 245-251 (1992)
Title Extensive size polymorphism of the human keratin 10 chain resides in the C-terminal V2 subdomain due to variable numbers and sizes of glycine loops .
Author Korge BP, Gan SQ, McBride OW, Mischke D and Steinert PM.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (3), 910-914 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.