• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 10 (KRT10), mRNA.


RefSeq Accession Definition Services Price Order
NM_000421 Homo sapiens keratin 10 (KRT10), mRNA. ORF Sequence $508.95
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000421.3, 195972865
Length 2162 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens keratin 10 (KRT10), mRNA.
Product keratin, type I cytoskeletal 10
Comment

Summary: This gene encodes a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in this gene are associated with epidermolytic hyperkeratosis. This gene is located within a cluster of keratin family members on chromosome 17q21. [provided by RefSeq, Jul 2008].

RefSeq NP_000412.3
CDS 27..1781
Misc Feature(1)27..461
Misc Feature(2)27..461
Misc Feature(3)72..74
Misc Feature(4)150..152
Misc Feature(5)459..1388
Misc Feature(6)462..1394
Misc Feature(7)462..569
Misc Feature(8)570..632
Misc Feature(9)633..908
Misc Feature(10)909..977
Misc Feature(11)978..1394
Misc Feature(12)1395..1778
Exon (1)1..653
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (2)654..736
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (3)737..893
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (4)894..1055
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (5)1056..1181
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (6)1182..1399
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (7)1400..1774
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Exon (8)1775..2140
Gene:KRT10
Gene Synonym:BCIE; BIE; CK10; EHK; K10; KPP
Translation MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRG SSGGGCFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSFGGG GFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKE WYEKHGNSHQGEPRDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYEN EVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTG DVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISS YKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQ IRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGG GSSGGGHGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGG GYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(37)-t, cdbSNP:142158041
complement(70)-t, cdbSNP:28411890
complement(73)-t, cdbSNP:146957992
complement(96..98)-, tccdbSNP:148510452
complement(123)-t, adbSNP:141187850
complement(124)-g, adbSNP:151149062
complement(151)-g, adbSNP:142050024
complement(155)-g, adbSNP:149227921
complement(156)-g, cdbSNP:145403476
complement(161)-t, cdbSNP:150048434
complement(179)-c, adbSNP:151143129
complement(184)-t, cdbSNP:146835683
complement(188)-t, adbSNP:200567513
complement(248)-g, adbSNP:201089561
complement(283)-t, cdbSNP:117610737
complement(328)-g, c, adbSNP:4261597
complement(331)-g, adbSNP:114467326
complement(338)-t, cdbSNP:141830953
complement(347)-g, adbSNP:148701068
complement(365)-g, adbSNP:144138576
complement(390)-g, adbSNP:201879590
complement(397)-c, adbSNP:200060640
complement(401)-g, adbSNP:71371451
complement(402)-t, cdbSNP:77919366
complement(431)-t, cdbSNP:1132252
complement(440)-t, cdbSNP:1132253
complement(443)-t, cdbSNP:1132254
complement(456)-t, cdbSNP:146976249
complement(475)-t, g, cdbSNP:58901407
complement(483)-g, cdbSNP:61460100
complement(486)-c, adbSNP:57784225
complement(491..492)-cc, aadbSNP:60712939
492+a, c, g, tdbSNP:58852768
493+a, c, g, tdbSNP:58075662
complement(495)-t, cdbSNP:1132255
complement(498)-g, cdbSNP:59175042
complement(500)-t, cdbSNP:1132256
complement(504)-t, gdbSNP:58414354
complement(505)-c, adbSNP:58735429
complement(507..512)-, ttggacdbSNP:56809156
complement(507)-t, cdbSNP:1132257
complement(508)-t, cdbSNP:60118264
complement(567)-t, cdbSNP:1132258
complement(592)-g, adbSNP:1132259
complement(596)-t, cdbSNP:200118465
complement(600)-t, cdbSNP:142767279
complement(617)-g, adbSNP:200665804
complement(671)-t, adbSNP:1132260
complement(677)-g, adbSNP:138435395
complement(679)-g, adbSNP:200239146
complement(767)-dbSNP:
complement(767)-g, adbSNP:185881153
complement(768)-t, cdbSNP:201691005
complement(782)-g, adbSNP:150098320
complement(815)-g, adbSNP:140700628
complement(827)-t, cdbSNP:1132262
complement(833)-g, adbSNP:1132263
complement(840)-t, gdbSNP:201788518
complement(862)-t, cdbSNP:200397191
complement(869)-g, adbSNP:201038946
complement(874)-t, adbSNP:201886561
complement(883)-t, gdbSNP:61735162
complement(885)-g, adbSNP:150918499
complement(886)-g, adbSNP:1132264
complement(903)-dbSNP:
complement(903)-g, cdbSNP:1132265
complement(923)-t, cdbSNP:1132266
complement(932)-c, adbSNP:145899611
complement(1030)-t, cdbSNP:200563139
complement(1032)-t, cdbSNP:140697702
complement(1166)-dbSNP:
complement(1166)-g, cdbSNP:146855016
complement(1254)-dbSNP:
complement(1254)-g, cdbSNP:143780054
complement(1271)-t, cdbSNP:140096582
complement(1284)-g, cdbSNP:1132268
complement(1290..1291)-cg, gadbSNP:59075499
complement(1307..1308)-cc, aadbSNP:267607377
complement(1326)-t, cdbSNP:60035576
complement(1340..1341)-, cdbSNP:267607379
complement(1341)-g, adbSNP:61434181
complement(1351)-t, adbSNP:58026994
complement(1359)-g, adbSNP:267607380
complement(1363)-t, cdbSNP:62651994
complement(1366)-c, adbSNP:267607378
complement(1372)-g, adbSNP:267607383
complement(1377)-g, adbSNP:1132269
complement(1381)-t, cdbSNP:62651995
complement(1384)-t, cdbSNP:62652043
complement(1419)-dbSNP:
complement(1419)-t, cdbSNP:201994123
complement(1444..1445)-, gagcttccgccgccgdbSNP:11268553
complement(1444)-t, gdbSNP:201343749
complement(1460..1474)-, gagcttccgccgccgdbSNP:72074479
complement(1473..1474)-, gagcttccgccgccgdbSNP:35710360
complement(1476..1477)-, cdbSNP:267607382
complement(1482..1483)-, cttdbSNP:72471582
complement(1485)-g, adbSNP:17855579
complement(1572..1577)-t, ggaagcdbSNP:267607385
complement(1581)-t, cdbSNP:199819272
complement(1586..1587)-, cgdbSNP:267607384
complement(1605)-t, cdbSNP:201576759
complement(1623)-t, cdbSNP:184159044
complement(1709..1710)-, gctgccgccgccgtatccgccgccggagctdbSNP:11275186
complement(1735)-g, cdbSNP:112018671
complement(1750)-c, adbSNP:199785115
complement(1776)-dbSNP:
complement(1776)-g, adbSNP:199646609
complement(1788)-g, adbSNP:79174420
complement(1823)-g, adbSNP:71371449
complement(1846)-g, adbSNP:12231
complement(1875)-g, adbSNP:117588718
complement(1897)-g, adbSNP:1132367
complement(1907)-g, cdbSNP:141815199
complement(1909)-g, adbSNP:111849607
complement(1928)-t, gdbSNP:112791986
complement(1962)-t, cdbSNP:201389981
complement(2036)-g, adbSNP:192578662
complement(2092)-g, adbSNP:112000562
Gene SymbolKRT10
Gene SynonymBCIE; BIE; CK10; EHK; K10; KPP
Chromosome17
Locus Map17q21
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000421 Homo sapiens keratin 10 (KRT10), mRNA. Full Length $626.98
ORF Sequence $508.95
Title Epidemiology and clinical characteristics of bullous congenital ichthyosiform erythroderma (keratinolytic ichthyosis) in Japan: results from a nationwide survey .
Author Kurosawa,M., Takagi,A., Tamakoshi,A., Kawamura,T., Inaba,Y., Yokoyama,K., Kitajima,Y., Aoyama,Y., Iwatsuki,K. and Ikeda,S.
Journal J. Am. Acad. Dermatol. 68 (2), 278-283 (2013)
Title Keratin 10-positive orthokeratotic dysplasia: a new leucoplakia-type precancerous entity of the oral mucosa .
Author Kobayashi,T., Maruyama,S., Abe,T., Cheng,J., Takagi,R., Saito,C. and Saku,T.
Journal Histopathology 61 (5), 910-920 (2012)
Title Molecular mimicry between HSP 65 of Mycobacterium leprae and cytokeratin 10 of the host keratin; role in pathogenesis of leprosy .
Author Singh,I., Yadav,A.R., Mohanty,K.K., Katoch,K., Bisht,D., Sharma,P., Sharma,B., Gupta,U.D. and Sengupta,U.
Journal Cell. Immunol. 278 (1-2), 63-75 (2012)
Title Cellular senescence increases expression of bacterial ligands in the lungs and is positively correlated with increased susceptibility to pneumococcal pneumonia .
Author Shivshankar,P., Boyd,A.R., Le Saux,C.J., Yeh,I.T. and Orihuela,C.J.
Journal Aging Cell 10 (5), 798-806 (2011)
Title Expanding the keratin mutation database: novel and recurrent mutations and genotype-phenotype correlations in 28 patients with epidermolytic ichthyosis .
Author Arin,M.J., Oji,V., Emmert,S., Hausser,I., Traupe,H., Krieg,T. and Grimberg,G.
Journal Br. J. Dermatol. 164 (2), 442-447 (2011)
Title Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes .
Author Rasmussen,H.H., van Damme,J., Puype,M., Gesser,B., Celis,J.E. and Vandekerckhove,J.
Journal Electrophoresis 13 (12), 960-969 (1992)
Title The genetic basis of epidermolytic hyperkeratosis: a disorder of differentiation-specific epidermal keratin genes .
Author Cheng,J., Syder,A.J., Yu,Q.C., Letai,A., Paller,A.S. and Fuchs,E.
Journal Cell 70 (5), 811-819 (1992)
Title Mutations in the rod domains of keratins 1 and 10 in epidermolytic hyperkeratosis .
Author Rothnagel,J.A., Dominey,A.M., Dempsey,L.D., Longley,M.A., Greenhalgh,D.A., Gagne,T.A., Huber,M., Frenk,E., Hohl,D. and Roop,D.R.
Journal Science 257 (5073), 1128-1130 (1992)
Title Exons I and VII of the gene (Ker10) encoding human keratin 10 undergo structural rearrangements within repeats .
Author Tkachenko,A.V., Buchman,V.L., Bliskovsky,V.V., Shvets,Yu.P. and Kisselev,L.L.
Journal Gene 116 (2), 245-251 (1992)
Title Extensive size polymorphism of the human keratin 10 chain resides in the C-terminal V2 subdomain due to variable numbers and sizes of glycine loops .
Author Korge,B.P., Gan,S.Q., McBride,O.W., Mischke,D. and Steinert,P.M.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (3), 910-914 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878