• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens laminin, alpha 2 (LAMA2), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_000426 Homo sapiens laminin, alpha 2 (LAMA2), transcript variant 1, mRNA. ORF Sequence Quote
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000426.3, 119466530
Length 9708 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens laminin, alpha 2 (LAMA2), transcript variant 1, mRNA.
Product laminin subunit alpha-2 isoform a precursor
Comment

Summary: Laminin, an extracellular protein, is a major component of the basement membrane. It is thought to mediate the attachment, migration, and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. It is composed of three subunits, alpha, beta, and gamma, which are bound to each other by disulfide bonds into a cross-shaped molecule. This gene encodes the alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Mutations in this gene have been identified as the cause of congenital merosin-deficient muscular dystrophy. Two transcript variants encoding different proteins have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (a).

RefSeq NP_000417.2
CDS 106..9474
Misc Feature(1)220..960
Misc Feature(2)964..1107
Misc Feature(3)order(964..966,970..972,1003..1005,1024..1026,1030..1032,
Misc Feature(4)<1021..1095
Misc Feature(5)1342..1500
Misc Feature(6)1345..1503
Misc Feature(7)order(1345..1347,1351..1353,1381..1383,1429..1431,
Misc Feature(8)1507..1632
Misc Feature(9)1510..1650
Misc Feature(10)order(1510..1512,1516..1518,1561..1563,1567..1569,
Misc Feature(11)1837..2235
Misc Feature(12)2371..2520
Misc Feature(13)2374..2502
Misc Feature(14)order(2374..2376,2380..2382,2401..2403,2422..2424,
Misc Feature(15)2521..2694
Misc Feature(16)2524..2691
Misc Feature(17)order(2524..2526,2530..2532,2569..2571,2599..2601,
Misc Feature(18)2695..2853
Misc Feature(19)2698..2859
Misc Feature(20)order(2698..2700,2704..2706,2740..2742,2761..2763,
Misc Feature(21)2854..2994
Misc Feature(22)2857..2997
Misc Feature(23)order(2857..2859,2863..2865,2893..2895,2914..2916,
Misc Feature(24)3001..3135
Misc Feature(25)3004..3138
Misc Feature(26)order(3004..3006,3010..3012,3040..3042,3058..3060,
Misc Feature(27)3142..3279
Misc Feature(28)3145..3276
Misc Feature(29)order(3145..3147,3151..3153,3172..3174,3193..3195,
Misc Feature(30)3280..3408
Misc Feature(31)3283..3429
Misc Feature(32)order(3283..3285,3289..3291,3319..3321,3340..3342,
Misc Feature(33)3421..3594
Misc Feature(34)3421..3594
Misc Feature(35)order(3421..3423,3427..3429,3457..3459,3505..3507,
Misc Feature(36)3790..4197
Misc Feature(37)3850..3852
Misc Feature(38)4360..4506
Misc Feature(39)4363..4503
Misc Feature(40)order(4363..4365,4369..4371,4390..4392,4411..4413,
Misc Feature(41)4510..4680
Misc Feature(42)4510..4677
Misc Feature(43)order(4510..4512,4516..4518,4555..4557,4585..4587,
Misc Feature(44)4681..4827
Misc Feature(45)4684..4815
Misc Feature(46)order(4684..4686,4690..4692,4720..4722,4741..4743,
Misc Feature(47)4825..6537
Misc Feature(48)4867..5664
Misc Feature(49)<5527..5829
Misc Feature(50)5686..6348
Misc Feature(51)6214..6624
Misc Feature(52)6553..7032
Misc Feature(53)7123..7608
Misc Feature(54)7687..8175
Misc Feature(55)8401..8850
Misc Feature(56)8926..9384
Exon (1)1..217
Gene:LAMA2
Gene Synonym:LAMM
Exon (2)218..388
Gene:LAMA2
Gene Synonym:LAMM
Exon (3)389..501
Gene:LAMA2
Gene Synonym:LAMM
Exon (4)502..744
Gene:LAMA2
Gene Synonym:LAMM
Exon (5)745..924
Gene:LAMA2
Gene Synonym:LAMM
Exon (6)925..1014
Gene:LAMA2
Gene Synonym:LAMM
Exon (7)1015..1132
Gene:LAMA2
Gene Synonym:LAMM
Exon (8)1133..1311
Gene:LAMA2
Gene Synonym:LAMM
Exon (9)1312..1411
Gene:LAMA2
Gene Synonym:LAMM
Exon (10)1412..1572
Gene:LAMA2
Gene Synonym:LAMM
Exon (11)1573..1713
Gene:LAMA2
Gene Synonym:LAMM
Exon (12)1714..1887
Gene:LAMA2
Gene Synonym:LAMM
Exon (13)1888..1989
Gene:LAMA2
Gene Synonym:LAMM
Exon (14)1990..2201
Gene:LAMA2
Gene Synonym:LAMM
Exon (15)2202..2313
Gene:LAMA2
Gene Synonym:LAMM
Exon (16)2314..2427
Gene:LAMA2
Gene Synonym:LAMM
Exon (17)2428..2555
Gene:LAMA2
Gene Synonym:LAMM
Exon (18)2556..2642
Gene:LAMA2
Gene Synonym:LAMM
Exon (19)2643..2854
Gene:LAMA2
Gene Synonym:LAMM
Exon (20)2855..2961
Gene:LAMA2
Gene Synonym:LAMM
Exon (21)2962..3142
Gene:LAMA2
Gene Synonym:LAMM
Exon (22)3143..3279
Gene:LAMA2
Gene Synonym:LAMM
Exon (23)3280..3516
Gene:LAMA2
Gene Synonym:LAMM
Exon (24)3517..3660
Gene:LAMA2
Gene Synonym:LAMM
Exon (25)3661..3840
Gene:LAMA2
Gene Synonym:LAMM
Exon (26)3841..4029
Gene:LAMA2
Gene Synonym:LAMM
Exon (27)4030..4163
Gene:LAMA2
Gene Synonym:LAMM
Exon (28)4164..4281
Gene:LAMA2
Gene Synonym:LAMM
Exon (29)4282..4416
Gene:LAMA2
Gene Synonym:LAMM
Exon (30)4417..4541
Gene:LAMA2
Gene Synonym:LAMM
Exon (31)4542..4628
Gene:LAMA2
Gene Synonym:LAMM
Exon (32)4629..4822
Gene:LAMA2
Gene Synonym:LAMM
Exon (33)4823..4965
Gene:LAMA2
Gene Synonym:LAMM
Exon (34)4966..5064
Gene:LAMA2
Gene Synonym:LAMM
Exon (35)5065..5176
Gene:LAMA2
Gene Synonym:LAMM
Exon (36)5177..5339
Gene:LAMA2
Gene Synonym:LAMM
Exon (37)5340..5550
Gene:LAMA2
Gene Synonym:LAMM
Exon (38)5551..5667
Gene:LAMA2
Gene Synonym:LAMM
Exon (39)5668..5831
Gene:LAMA2
Gene Synonym:LAMM
Exon (40)5832..5970
Gene:LAMA2
Gene Synonym:LAMM
Exon (41)5971..6073
Gene:LAMA2
Gene Synonym:LAMM
Exon (42)6074..6190
Gene:LAMA2
Gene Synonym:LAMM
Exon (43)6191..6373
Gene:LAMA2
Gene Synonym:LAMM
Exon (44)6374..6379
Gene:LAMA2
Gene Synonym:LAMM
Exon (45)6380..6534
Gene:LAMA2
Gene Synonym:LAMM
Exon (46)6535..6678
Gene:LAMA2
Gene Synonym:LAMM
Exon (47)6679..6812
Gene:LAMA2
Gene Synonym:LAMM
Exon (48)6813..6972
Gene:LAMA2
Gene Synonym:LAMM
Exon (49)6973..7097
Gene:LAMA2
Gene Synonym:LAMM
Exon (50)7098..7260
Gene:LAMA2
Gene Synonym:LAMM
Exon (51)7261..7405
Gene:LAMA2
Gene Synonym:LAMM
Exon (52)7406..7544
Gene:LAMA2
Gene Synonym:LAMM
Exon (53)7545..7556
Gene:LAMA2
Gene Synonym:LAMM
Exon (54)7557..7677
Gene:LAMA2
Gene Synonym:LAMM
Exon (55)7678..7854
Gene:LAMA2
Gene Synonym:LAMM
Exon (56)7855..8003
Gene:LAMA2
Gene Synonym:LAMM
Exon (57)8004..8180
Gene:LAMA2
Gene Synonym:LAMM
Exon (58)8181..8349
Gene:LAMA2
Gene Synonym:LAMM
Exon (59)8350..8462
Gene:LAMA2
Gene Synonym:LAMM
Exon (60)8463..8652
Gene:LAMA2
Gene Synonym:LAMM
Exon (61)8653..8808
Gene:LAMA2
Gene Synonym:LAMM
Exon (62)8809..8962
Gene:LAMA2
Gene Synonym:LAMM
Exon (63)8963..9093
Gene:LAMA2
Gene Synonym:LAMM
Exon (64)9094..9316
Gene:LAMA2
Gene Synonym:LAMM
Exon (65)9317..9693
Gene:LAMA2
Gene Synonym:LAMM
Translation MPGAAGVLLLLLLSGGLGGVQAQRPQQQRQSQAHQQRGLFPAVLNLASNALITTNATCGE KGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIE YHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLY NIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARY IRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDP ATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVA RRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIG SLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNED PCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDM SGWYLTDLPGRIRVAPQQDDLDSPQQISISNAEARQALPHSYYWSAPAPYLGNKLPAVGG QLTFTISYDLEEEEEDTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESF TIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAA VEVCQCPPGYTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHT GGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYT GPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCEL CADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQS ARGCVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLG NNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCN CHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNV EGIHCDRCRPGKFGLDAKNPLGCSSCYCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDE ALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFE AREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRV HRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKC DCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQ HHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRG YEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC KHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAPYKMLYGLENMTQELK HLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGE FIKELARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIA EDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVDDAWDLLREATDKIREA NRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQ TKLPPMSEELNDKIDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFN ATAAFKAYSNIKDYIDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGCLQKSFRILNE AKKLANDVKENEDHLNGLKTRIENADARNGDLLRTLNDTLGKLSAIPNDTAAKLQAVKDK ARQANDTAKDVLAQITELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNKIIADADATVK NLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKP EIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYP DLTIDDSYWYRIVASRTGRNGTISVRALDGPKASIVPSTHHSTSPPGYTILDVDANAMLF VGGLTGKLKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGT IQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLRDFMSVELTDGHIKV SYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGL DLKADDKIYFGGLPTLRNLSMKARPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGVTKG CSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQ TGQAYYVILLNRGRLEVHLSTGARTMRKIVIRPEPNLFHDGREHSVHVERTRGIFTVQVD ENRRYMQNLTVEQPIEVKKLFVGGAPPEFQPSPLRNIPPFEGCIWNLVINSVPMDFARPV SFKNADIGRCAHQKLREDEDGAAPAEIVIQPEPVPTPAFPTPTPVLTHGPCAAESEPALL IGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRN GLPYFSYDLGSGDTHTMIPTKINDGQWHKIKIMRSKQEGILYVDGASNRTISPKKADILD VVGMLYVGGLPINYTTRRIGPVTYSIDGCVRNLHMAEAPADLEQPTSSFHVGTCFANAQR GTYFDGTGFAKAVGGFKVGLDLLVEFEFRTTTTTGVLLGISSQKMDGMGIEMIDEKLMFH VDNGAGRFTAVYDAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADT NDPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCP AN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
7+dbSNP:
7+a, gdbSNP:111531732
34+a, gdbSNP:10080633
179+c, tdbSNP:145310035
254+dbSNP:
254+c, tdbSNP:191899712
261+c, tdbSNP:1140366
297+a, cdbSNP:77526545
342+a, gdbSNP:201402165
345+a, cdbSNP:201028930
356+a, gdbSNP:148607737
360+c, tdbSNP:142083777
381+c, tdbSNP:112120067
386+a, gdbSNP:151168826
393+dbSNP:
393+g, tdbSNP:34626728
397+c, gdbSNP:140199131
399+a, gdbSNP:145752259
411+a, tdbSNP:146611180
461+c, tdbSNP:113503324
486+a, cdbSNP:4404787
513+dbSNP:
513+c, tdbSNP:145149634
515+c, tdbSNP:138964034
516+a, gdbSNP:149347601
542+c, gdbSNP:143680577
548+a, gdbSNP:148103319
572+g, tdbSNP:143923200
584+a, tdbSNP:147398243
593+a, tdbSNP:201175472
638+c, tdbSNP:148665727
647+a, gdbSNP:143664472
659+a, gdbSNP:150586612
717+c, gdbSNP:201236591
728+a, cdbSNP:183890063
780+dbSNP:
780+c, tdbSNP:139665175
781+a, gdbSNP:149654569
792+c, tdbSNP:112786770
820+c, tdbSNP:145465528
823+a, gdbSNP:3778142
984+dbSNP:
984+c, tdbSNP:148419866
1007+c, tdbSNP:144053918
1008+a, gdbSNP:148655840
1027+dbSNP:
1027+a, gdbSNP:146462599
1051+a, gdbSNP:141340479
1053+c, tdbSNP:200841688
1175+dbSNP:
1175+a, gdbSNP:145129199
1189+a, tdbSNP:191912891
1190+g, tdbSNP:182958473
1354+dbSNP:
1354+a, gdbSNP:201009816
1406+a, gdbSNP:200097756
1413+dbSNP:
1413+g, tdbSNP:41285286
1469+a, gdbSNP:201177178
1478+a, gdbSNP:140604077
1496+c, tdbSNP:150394215
1505+a, gdbSNP:138162760
1508+c, gdbSNP:111695726
1559+c, tdbSNP:146522136
1596+dbSNP:
1596+a, gdbSNP:2306220
1600+c, tdbSNP:143626559
1638+c, tdbSNP:9492266
1651+c, gdbSNP:141000358
1685+a, gdbSNP:121913574
1714+dbSNP:
1714+a, tdbSNP:148262047
1726+a, gdbSNP:141363186
1735+g, tdbSNP:200939383
1739+a, tdbSNP:118083923
1750+c, tdbSNP:139070796
1755+a, gdbSNP:899353
1784+a, gdbSNP:61620549
1806+c, tdbSNP:111381107
1820+c, tdbSNP:149811988
1827+c, tdbSNP:145822425
1842+a, gdbSNP:149000261
1876+c, tdbSNP:142965498
1877+g, tdbSNP:28384270
1903+dbSNP:
1903+c, tdbSNP:36044314
1919+c, tdbSNP:112388307
1921+a, gdbSNP:113022759
1961+c, tdbSNP:3816665
1966..1967+, acgtgttcdbSNP:202247791
1966+c, tdbSNP:139093923
1978+a, gdbSNP:141658354
2035+dbSNP:
2035+c, gdbSNP:35879899
2106+c, tdbSNP:138600346
2114+a, gdbSNP:149305108
2154..2155+, agdbSNP:202247790
2220+dbSNP:
2220+g, tdbSNP:149753273
2226+c, tdbSNP:145622088
2237+a, gdbSNP:201122410
2292+c, gdbSNP:142345851
2322+dbSNP:
2322+g, tdbSNP:192317605
2344+a, gdbSNP:145940188
2345+c, gdbSNP:139843107
2393+c, tdbSNP:141521127
2409+c, tdbSNP:142126511
2410+a, gdbSNP:150753170
2430+dbSNP:
2430+a, cdbSNP:139351727
2481+c, tdbSNP:150046431
2484+c, tdbSNP:201162084
2487+c, tdbSNP:147744763
2488+a, g, tdbSNP:149896793
2514+c, tdbSNP:144580350
2520+a, gdbSNP:147880506
2535+a, cdbSNP:147572139
2566+dbSNP:
2566+a, gdbSNP:186538779
2567+c, tdbSNP:117422805
2581+c, tdbSNP:118147866
2593+c, tdbSNP:140283614
2598+c, tdbSNP:201970154
2616+a, cdbSNP:201420653
2617+a, gdbSNP:150361703
2654+dbSNP:
2654+c, tdbSNP:34487290
2676+a, gdbSNP:138080217
2677+c, tdbSNP:148749681
2689+c, tdbSNP:121913573
2775+a, cdbSNP:201625640
2841+a, gdbSNP:142671449
2860+dbSNP:
2860+c, tdbSNP:138018456
2861+a, cdbSNP:35277491
2871+c, tdbSNP:149254699
2872+a, gdbSNP:144492513
2904+a, gdbSNP:1027199
2936+a, gdbSNP:141920360
2986+dbSNP:
2986+a, gdbSNP:147301872
3006+a, cdbSNP:121913577
3037+a, gdbSNP:202050052
3083+a, gdbSNP:140989143
3098+a, gdbSNP:144946631
3108+c, tdbSNP:147964120
3109+a, gdbSNP:200953311
3119+a, gdbSNP:139244736
3190+dbSNP:
3190+a, cdbSNP:145420388
3191+a, gdbSNP:149993931
3203+c, gdbSNP:113957073
3249+a, cdbSNP:147249027
3259+a, gdbSNP:149165006
3284+dbSNP:
3284+g, tdbSNP:79936200
3322+a, gdbSNP:145407076
3349+c, tdbSNP:146490004
3360+c, tdbSNP:200075509
3378+a, gdbSNP:201638947
3389+a, gdbSNP:201518199
3401+c, tdbSNP:35065563
3517+dbSNP:
3517+c, tdbSNP:2306942
3533+c, tdbSNP:200140103
3534+a, cdbSNP:200646230
3550+c, tdbSNP:201540948
3618+c, tdbSNP:138782094
3624+c, tdbSNP:141150540
3637+c, tdbSNP:34505698
3687+dbSNP:
3687+c, tdbSNP:137962409
3688+c, tdbSNP:1063373
3702+c, tdbSNP:199904029
3718+c, tdbSNP:35889149
3721+a, gdbSNP:190362395
3733+a, gdbSNP:147291222
3767+g, tdbSNP:140895872
3790+c, tdbSNP:143247439
3799+a, cdbSNP:201391981
3801+g, tdbSNP:147533827
3823+c, tdbSNP:121913569
3890..3891+dbSNP:
3890..3891+, gdbSNP:35737747
3890+a, gdbSNP:148597169
3922+c, tdbSNP:200625655
3944+c, tdbSNP:142745227
3966+c, tdbSNP:138702650
3971+a, gdbSNP:199833683
4074+dbSNP:
4074+a, tdbSNP:112327654
4102+c, tdbSNP:151038492
4115+a, gdbSNP:139739075
4118+c, tdbSNP:35581247
4150+a, gdbSNP:150743601
4165+dbSNP:
4165+a, gdbSNP:143674727
4228+a, gdbSNP:146827694
4284+dbSNP:
4284+a, gdbSNP:141000104
4310+a, gdbSNP:144830879
4363+c, tdbSNP:145592885
4413+c, tdbSNP:201814504
4453+dbSNP:
4453+c, tdbSNP:200923373
4454+a, gdbSNP:148905630
4567+dbSNP:
4567+a, gdbSNP:200961385
4575+a, gdbSNP:35089085
4589+c, tdbSNP:147987573
4592+c, tdbSNP:147077184
4648..4649+dbSNP:
4648..4649+, gdbSNP:36123101
4750+c, tdbSNP:121913575
4786+a, cdbSNP:4143752
4855+dbSNP:
4855+a, gdbSNP:117781224
4868+g, tdbSNP:138765295
4873+a, gdbSNP:143206604
4874+a, gdbSNP:112172940
4877+a, gdbSNP:143986011
4974+dbSNP:
4974+a, gdbSNP:147510409
5014+a, gdbSNP:138303386
5031+a, gdbSNP:62421010
5035+a, gdbSNP:182762857
5040+g, tdbSNP:35579821
5049+c, tdbSNP:111632017
5050+a, c, gdbSNP:143215851
5057+c, tdbSNP:112457889
5061+c, gdbSNP:17057184
5066+dbSNP:
5066+a, cdbSNP:78642093
5097+c, tdbSNP:143078882
5126+a, gdbSNP:143333246
5155+a, gdbSNP:201632009
5194+dbSNP:
5194+a, gdbSNP:193292430
5226+c, tdbSNP:151199929
5276+c, tdbSNP:140373926
5331+c, tdbSNP:201149159
5352+dbSNP:
5352+c, tdbSNP:149951387
5389+c, tdbSNP:145126760
5390+a, gdbSNP:138296015
5396+a, gdbSNP:141950826
5402+a, gdbSNP:145815606
5422+c, tdbSNP:138695453
5424+a, gdbSNP:201309072
5432+c, tdbSNP:200123250
5510+a, gdbSNP:141235562
5566+dbSNP:
5566+a, gdbSNP:201172088
5571+a, gdbSNP:3749877
5607+a, gdbSNP:3749878
5635+a, cdbSNP:56173620
5636+a, gdbSNP:150691000
5654+a, gdbSNP:138983455
5663+g, tdbSNP:141911213
5673+dbSNP:
5673+c, tdbSNP:146304630
5738+c, tdbSNP:139586720
5783+c, tdbSNP:192672030
5794+a, gdbSNP:200518204
5874+dbSNP:
5874+a, gdbSNP:200582139
5930+c, gdbSNP:144318893
5938+a, gdbSNP:3828736
5954+a, gdbSNP:144301099
6004+dbSNP:
6004+, gdbSNP:5879947
6014+c, gdbSNP:148451013
6050+a, gdbSNP:185009221
6055+c, tdbSNP:142637286
6085+dbSNP:
6085+a, cdbSNP:186382094
6107+a, gdbSNP:151009169
6148+a, cdbSNP:201248317
6161+c, gdbSNP:142276947
6179+a, cdbSNP:180766121
6233+dbSNP:
6233+a, gdbSNP:144155507
6241+c, gdbSNP:201265215
6245+c, tdbSNP:112487709
6255+c, tdbSNP:114766691
6266+a, gdbSNP:56035053
6272+a, cdbSNP:73775407
6274+c, gdbSNP:144970030
6292+a, gdbSNP:187633696
6311+a, gdbSNP:117884199
6312+a, cdbSNP:143343647
6333+c, tdbSNP:138994246
6334+a, gdbSNP:142264176
6339+a, gdbSNP:56920166
6340+a, tdbSNP:189718453
6341+c, tdbSNP:200928844
6342+a, gdbSNP:2297738
6382+dbSNP:
6382+a, gdbSNP:141857004
6384+c, tdbSNP:141190803
6427+c, tdbSNP:139824017
6450+c, tdbSNP:200364660
6531+c, tdbSNP:150730793
6611+dbSNP:
6611+a, gdbSNP:144845618
6630+a, gdbSNP:199676897
6649+c, tdbSNP:200550594
6652+c, tdbSNP:140574226
6734+dbSNP:
6734+c, tdbSNP:78880369
6754+a, gdbSNP:147857398
6756+a, gdbSNP:139445956
6786+a, tdbSNP:140092288
6797+a, gdbSNP:142536231
6802+a, gdbSNP:150945378
6893+dbSNP:
6893+c, tdbSNP:56209257
6911+c, tdbSNP:150237160
6937+a, gdbSNP:146854942
6989+dbSNP:
6989+a, gdbSNP:142164767
7156+dbSNP:
7156+a, gdbSNP:140680416
7162+c, tdbSNP:145885540
7178+a, gdbSNP:138497575
7214+c, tdbSNP:149561195
7216+g, tdbSNP:150644209
7217+g, tdbSNP:201274841
7252+c, tdbSNP:121913576
7254+a, gdbSNP:113590513
7311+dbSNP:
7311+c, tdbSNP:148313644
7312+a, gdbSNP:141476898
7336+a, gdbSNP:199814707
7344+c, tdbSNP:147448682
7350+a, gdbSNP:113359126
7355+a, gdbSNP:147185142
7449+dbSNP:
7449+c, tdbSNP:199931560
7500+c, tdbSNP:140483001
7520+g, tdbSNP:200921233
7536+a, tdbSNP:34367843
7620+dbSNP:
7620+a, gdbSNP:200364360
7676+a, gdbSNP:201918511
7693+dbSNP:
7693+a, gdbSNP:199905856
7735+a, gdbSNP:147430700
7745+a, gdbSNP:115488979
7764+a, gdbSNP:149867744
7786+a, gdbSNP:200341138
7791+c, tdbSNP:201578157
7796+c, tdbSNP:121913570
7813+a, gdbSNP:144901086
7837+c, tdbSNP:121913572
7865+dbSNP:
7865+c, tdbSNP:2229848
7877+a, gdbSNP:200095274
7916+a, gdbSNP:200853002
7933+a, gdbSNP:200710385
7935+c, gdbSNP:2229849
7950+a, g, tdbSNP:2229850
7973+a, cdbSNP:188069926
7974+a, gdbSNP:140658201
7980+c, tdbSNP:144448521
7986+g, tdbSNP:202247792
8011+dbSNP:
8011+a, gdbSNP:2244008
8070+a, cdbSNP:141101234
8082+a, gdbSNP:201597970
8083+a, cdbSNP:201587923
8088+c, tdbSNP:150184189
8090+c, tdbSNP:138732723
8095+g, tdbSNP:200094005
8133+a, gdbSNP:35313209
8144+c, tdbSNP:74973588
8157+a, gdbSNP:201984588
8165+c, tdbSNP:147057821
8229+dbSNP:
8229+a, tdbSNP:34997144
8231+g, tdbSNP:199714288
8252+a, gdbSNP:142781107
8253+c, tdbSNP:147407422
8257+a, gdbSNP:148051442
8261+a, gdbSNP:141800867
8328+a, gdbSNP:150596964
8334+c, tdbSNP:80126151
8341+c, tdbSNP:3189618
8366+dbSNP:
8366+a, gdbSNP:139455685
8381+g, tdbSNP:201290833
8387+c, tdbSNP:115650537
8403+c, tdbSNP:145295628
8406+a, gdbSNP:139201047
8429+a, cdbSNP:144355650
8441+a, gdbSNP:202202014
8449+a, cdbSNP:146610482
8461+c, tdbSNP:199806512
8462+a, gdbSNP:149210847
8490+dbSNP:
8490+c, tdbSNP:142445491
8493+a, cdbSNP:184127828
8569+c, tdbSNP:199570699
8572+c, tdbSNP:151334775
8600+a, gdbSNP:140440782
8629+a, gdbSNP:140178576
8633+a, gdbSNP:73599293
8658+dbSNP:
8658+a, gdbSNP:138356821
8670+c, tdbSNP:201276440
8676+a, gdbSNP:188733817
8691+c, tdbSNP:142451929
8694+a, gdbSNP:200526970
8715+c, tdbSNP:199709403
8739+a, cdbSNP:201639153
8743+a, gdbSNP:146976290
8749+a, gdbSNP:138024644
8789+c, gdbSNP:200705442
8795+a, gdbSNP:201696115
8796+a, gdbSNP:2228599
8797+a, cdbSNP:200718262
8805+c, tdbSNP:112144397
8826+dbSNP:
8826+c, tdbSNP:144136299
8832+c, tdbSNP:148285711
8833+a, gdbSNP:141479751
8860+c, tdbSNP:143026295
8866+a, gdbSNP:139159258
8879+c, tdbSNP:77113162
8894+a, gdbSNP:201129835
8947+a, gdbSNP:143638361
8990+dbSNP:
8990+g, tdbSNP:202200494
8993+c, tdbSNP:139863980
8995+g, tdbSNP:202159946
8999+a, cdbSNP:149835486
9023+a, c, tdbSNP:145842163
9025+a, tdbSNP:140202046
9039+a, gdbSNP:186155089
9072+c, tdbSNP:113885801
9082+a, gdbSNP:145331792
9087+c, tdbSNP:79374915
9098+dbSNP:
9098+a, tdbSNP:147928808
9106+c, gdbSNP:189360899
9114+c, tdbSNP:148965119
9119+c, tdbSNP:75048006
9120+a, gdbSNP:2297739
9190+c, tdbSNP:34551216
9228+c, tdbSNP:61749497
9243+a, gdbSNP:201353206
9250+c, gdbSNP:146525742
9266+a, cdbSNP:151049890
9280+a, gdbSNP:200255425
9293+a, cdbSNP:151285465
9353+dbSNP:
9353+c, tdbSNP:80082613
9358+c, tdbSNP:121913571
9433+a, gdbSNP:140829166
9444+c, tdbSNP:182391310
9445+g, tdbSNP:200796753
9531+a, cdbSNP:1049473
9534..9535+, aaatdbSNP:140699127
9537..9538+, taaadbSNP:111454788
9592+c, tdbSNP:1049476
9663..9665+, aatdbSNP:150424940
9663+, aatdbSNP:5879951
9664+, atadbSNP:34947221
9665..9667+, ata, taadbSNP:3062450
9665..9667+, taadbSNP:112773001
9667+a, tdbSNP:201080256
9693+a, gdbSNP:113910634
Gene SymbolLAMA2
Gene SynonymLAMM
Chromosome6
Locus Map6q22-q23
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000426 Homo sapiens laminin, alpha 2 (LAMA2), transcript variant 1, mRNA. Full Length Quote
ORF Sequence Quote
NM_001079823 Homo sapiens laminin, alpha 2 (LAMA2), transcript variant 2, mRNA. Full Length Quote
ORF Sequence Quote
Title Identification of cell adhesive sequences in the N-terminal region of the laminin alpha2 chain .
Author Hozumi,K., Ishikawa,M., Hayashi,T., Yamada,Y., Katagiri,F., Kikkawa,Y. and Nomizu,M.
Journal J. Biol. Chem. 287 (30), 25111-25122 (2012)
Title Identification of GABRA1 and LAMA2 as new DNA methylation markers in colorectal cancer .
Author Lee,S., Oh,T., Chung,H., Rha,S., Kim,C., Moon,Y., Hoehn,B.D., Jeong,D., Lee,S., Kim,N., Park,C., Yoo,M. and An,S.
Journal Int. J. Oncol. 40 (3), 889-898 (2012)
Title Dilated cardiomyopathy with conduction defects in a patient with partial merosin deficiency due to mutations in the laminin-alpha2-chain gene: a chance association or a novel phenotype? .
Author Carboni,N., Marrosu,G., Porcu,M., Mateddu,A., Solla,E., Cocco,E., Maioli,M.A., Oppo,V., Piras,R. and Marrosu,M.G.
Journal Muscle Nerve 44 (5), 826-828 (2011)
Title Clinical and molecular characterization of limb-girdle muscular dystrophy due to LAMA2 mutations .
Author Gavassini,B.F., Carboni,N., Nielsen,J.E., Danielsen,E.R., Thomsen,C., Svenstrup,K., Bello,L., Maioli,M.A., Marrosu,G., Ticca,A.F., Mura,M., Marrosu,M.G., Soraru,G., Angelini,C., Vissing,J. and Pegoraro,E.
Journal Muscle Nerve 44 (5), 703-709 (2011)
Title Exome sequencing supports a de novo mutational paradigm for schizophrenia .
Author Xu,B., Roos,J.L., Dexheimer,P., Boone,B., Plummer,B., Levy,S., Gogos,J.A. and Karayiorgou,M.
Journal Nat. Genet. 43 (9), 864-868 (2011)
Title Mutations in the laminin alpha 2-chain gene (LAMA2) cause merosin-deficient congenital muscular dystrophy .
Author Helbling-Leclerc,A., Zhang,X., Topaloglu,H., Cruaud,C., Tesson,F., Weissenbach,J., Tome,F.M., Schwartz,K., Fardeau,M., Tryggvason,K. et al.
Journal Nat. Genet. 11 (2), 216-218 (1995)
Title Human laminin M chain: epitope analysis of its monoclonal antibodies by immunoscreening of cDNA clones and tissue expression .
Author Hori,H., Kanamori,T., Mizuta,T., Yamaguchi,N., Liu,Y. and Nagai,Y.
Journal J. Biochem. 116 (6), 1212-1219 (1994)
Title Dystroglycan is a binding protein of laminin and merosin in peripheral nerve .
Author Yamada,H., Shimizu,T., Tanaka,T., Campbell,K.P. and Matsumura,K.
Journal FEBS Lett. 352 (1), 49-53 (1994)
Title Distribution and isolation of four laminin variants; tissue restricted distribution of heterotrimers assembled from five different subunits .
Author Engvall,E., Earwicker,D., Haaparanta,T., Ruoslahti,E. and Sanes,J.R.
Journal Cell Regul. 1 (10), 731-740 (1990)
Title Merosin, a tissue-specific basement membrane protein, is a laminin-like protein .
Author Ehrig,K., Leivo,I., Argraves,W.S., Ruoslahti,E. and Engvall,E.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (9), 3264-3268 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878