• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens myosin, light chain 2, regulatory, cardiac, slow (MYL2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18354 Homo sapiens myosin, light chain 2, regulatory, cardiac, slow (MYL2), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu18354C Homo sapiens myosin, light chain 2, regulatory, cardiac, slow (MYL2), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000432.3, 190358510
Length 501 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens myosin, light chain 2, regulatory, cardiac, slow (MYL2), mRNA.
Product myosin regulatory light chain 2, ventricular/cardiac muscle isoform
Comment

Summary: Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008].

RefSeq NP_000423.2
CDS 72..572
Misc Feature(1)114..560
Misc Feature(2)114..560
Misc Feature(3)126..128
Misc Feature(4)153..>290
Misc Feature(5)order(180..182,186..188,192..194,213..215)
Misc Feature(6)375..551
Misc Feature(7)order(390..392,396..398,402..404,423..425,498..500,
Exon (1)1..74
Gene:MYL2
Gene Synonym:CMH10; MLC2
Exon (2)75..164
Gene:MYL2
Gene Synonym:CMH10; MLC2
Exon (3)165..240
Gene:MYL2
Gene Synonym:CMH10; MLC2
Exon (4)241..345
Gene:MYL2
Gene Synonym:CMH10; MLC2
Exon (5)346..424
Gene:MYL2
Gene Synonym:CMH10; MLC2
Exon (6)425..473
Gene:MYL2
Gene Synonym:CMH10; MLC2
Exon (7)474..830
Gene:MYL2
Gene Synonym:CMH10; MLC2
Translation MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR EMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(1)-dbSNP:
complement(1)-c, adbSNP:185700670
complement(26)-t, cdbSNP:368048109
complement(29)-g, cdbSNP:370643759
42+c, gdbSNP:2857718
complement(44)-g, adbSNP:377590769
complement(45)-t, cdbSNP:374106618
complement(58)-g, cdbSNP:371022137
68+c, tdbSNP:11538904
102+dbSNP:
102+a, gdbSNP:397516402
complement(104)-t, cdbSNP:199742269
complement(107)-g, adbSNP:139794370
123+c, tdbSNP:104894370
129+a, cdbSNP:199474816
complement(130)-g, adbSNP:113167834
135+a, gdbSNP:104894368
151+a, gdbSNP:397516408
153+a, gdbSNP:397516409
155+a, tdbSNP:397516410
203+dbSNP:
203+c, tdbSNP:2301610
206+c, tdbSNP:199474807
212+a, c, tdbSNP:199474808
complement(240)-g, cdbSNP:2428140
241+dbSNP:
241+a, gdbSNP:199474809
complement(243..244)-, ctdbSNP:35049558
244+a, gdbSNP:104894369
complement(255)-t, adbSNP:201728041
264+a, gdbSNP:397516398
complement(287)-t, cdbSNP:376506450
complement(293)-t, cdbSNP:372644111
complement(300)-t, cdbSNP:373475989
complement(311)-t, adbSNP:35714558
complement(314)-c, adbSNP:368851472
331+c, gdbSNP:397516399
complement(350)-dbSNP:
complement(350)-t, cdbSNP:28645088
354+c, gdbSNP:121913658
complement(375)-t, cdbSNP:369868176
381+a, gdbSNP:199474811
384+a, gdbSNP:397516401
395+c, tdbSNP:397516403
complement(413)-t, cdbSNP:199572927
429+dbSNP:
429+c, tdbSNP:397516404
complement(430)-t, cdbSNP:192057022
complement(437)-c, adbSNP:374439285
complement(445)-g, adbSNP:375667565
complement(446)-t, cdbSNP:190020833
complement(451)-g, adbSNP:141878747
452+a, gdbSNP:2233261
complement(472)-t, gdbSNP:143139258
489+dbSNP:
489+a, gdbSNP:4683
complement(491)-t, gdbSNP:369489428
complement(500)-g, cdbSNP:374328118
complement(504)-t, cdbSNP:199567559
complement(507)-t, cdbSNP:370075755
518+c, tdbSNP:397516405
complement(527)-g, adbSNP:199815885
complement(530)-g, cdbSNP:149078011
complement(539)-t, cdbSNP:137984206
555+a, gdbSNP:199474814
556+a, gdbSNP:397516406
559+a, cdbSNP:397516407
568+a, tdbSNP:199474815
582+c, tdbSNP:193922452
complement(583)-t, cdbSNP:145437002
590..591+c, gdbSNP:2857716
591+c, gdbSNP:2520215
complement(601)-g, adbSNP:371503244
complement(602)-t, cdbSNP:201099141
626+c, tdbSNP:1803295
complement(632)-t, gdbSNP:187600820
654+g, tdbSNP:14881
complement(654)-c, adbSNP:386534108
complement(689)-t, gdbSNP:192821062
708+c, tdbSNP:14880
complement(738)-g, adbSNP:376236989
751+c, tdbSNP:1803294
complement(800)-t, cdbSNP:182109599
complement(802..803)-, tdbSNP:35115498
complement(805)-, adbSNP:35511065
Gene SymbolMYL2
Gene SynonymCMH10; MLC2
Chromosome12
Locus Map12q24.11
Title Potential regulation of human muscle plasticity by MLC2 post-translational modifications during bed rest and countermeasures .
Author Stevens L, Bastide B, Hedou J, Cieniewski-Bernard C, Montel V, Cochon L, Dupont E and Mounier Y.
Journal Arch. Biochem. Biophys. 540 (1-2), 125-132 (2013)
Title New susceptibility loci in MYL2, C12orf51 and OAS1 associated with 1-h plasma glucose as predisposing risk factors for type 2 diabetes in the Korean population .
Author Go MJ, Hwang JY, Kim YJ, Hee Oh J, Kim YJ, Heon Kwak S, Soo Park K, Lee J, Kim BJ, Han BG, Cho MC, Cho YS and Lee JY.
Journal J. Hum. Genet. 58 (6), 362-365 (2013)
Title A genome-wide association study of a coronary artery disease risk variant .
Author Lee JY, Lee BS, Shin DJ, Woo Park K, Shin YA, Joong Kim K, Heo L, Young Lee J, Kyoung Kim Y, Jin Kim Y, Bum Hong C, Lee SH, Yoon D, Jung Ku H, Oh IY, Kim BJ, Lee J, Park SJ, Kim J, Kawk HK, Lee JE, Park HK, Lee JE, Nam HY, Park HY, Shin C, Yokota M, Asano H, Nakatochi M, Matsubara T, Kitajima H, Yamamoto K, Kim HL, Han BG, Cho MC, Jang Y, Kim HS, Euy Park J and Lee JY.
Journal J. Hum. Genet. 58 (3), 120-126 (2013)
Title Common variants at 12q24 are associated with drinking behavior in Han Chinese .
Author Yang X, Lu X, Wang L, Chen S, Li J, Cao J, Chen J, Hao Y, Li Y, Zhao L, Li H, Liu D, Wang L, Lu F, Shen C, Yu L, Wu X, Zhao Q, Ji X, Guo D, Peng X, Huang J and Gu D.
Journal Am. J. Clin. Nutr. 97 (3), 545-551 (2013)
Title Recessive MYL2 mutations cause infantile type I muscle fibre disease and cardiomyopathy .
Author Weterman MA, Barth PG, van Spaendonck-Zwarts KY, Aronica E, Poll-The BT, Brouwer OF, van Tintelen JP, Qahar Z, Bradley EJ, de Wissel M, Salviati L, Angelini C, van den Heuvel L, Thomasse YE, Backx AP, Nurnberg G, Nurnberg P and Baas F.
Journal Brain 136 (PT 1), 282-293 (2013)
Title The major protein expression profile and two-dimensional protein database of human heart .
Author Kovalyov LI, Shishkin SS, Efimochkin AS, Kovalyova MA, Ershova ES, Egorov TA and Musalyamov AK.
Journal Electrophoresis 16 (7), 1160-1169 (1995)
Title Hypertrophic Cardiomyopathy Overview .
Author Cirino,A.L. and Ho,C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Interaction of a conserved peptide domain in recombinant human ventricular myosin light chain-2 with myosin heavy chain .
Author Wadgaonkar R, Shafiq S, Rajmanickam C and Siddiqui MA.
Journal Cell. Mol. Biol. Res. 39 (1), 13-26 (1993)
Title Localization of the gene coding for ventricular myosin regulatory light chain (MYL2) to human chromosome 12q23-q24.3 .
Author Macera MJ, Szabo P, Wadgaonkar R, Siddiqui MA and Verma RS.
Journal Genomics 13 (3), 829-831 (1992)
Title Isolation and nucleotide sequence of the cDNA encoding human ventricular myosin light chain 2 .
Author Dalla Libera L, Hoffmann E, Floroff M and Jackowski G.
Journal Nucleic Acids Res. 17 (6), 2360 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.