• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens myosin, light chain 2, regulatory, cardiac, slow (MYL2), mRNA.


RefSeq Accession Definition Services Price Order
NM_000432 Homo sapiens myosin, light chain 2, regulatory, cardiac, slow (MYL2), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000432.3, 190358510
Length 855 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens myosin, light chain 2, regulatory, cardiac, slow (MYL2), mRNA.
Product myosin regulatory light chain 2, ventricular/cardiac muscle isoform
Comment

Summary: Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008].

RefSeq NP_000423.2
CDS 72..572
Misc Feature(1)114..560
Misc Feature(2)114..560
Misc Feature(3)126..128
Misc Feature(4)153..329
Misc Feature(5)order(180..182,186..188,192..194,213..215,291..293,
Misc Feature(6)375..551
Misc Feature(7)order(390..392,396..398,402..404,423..425,498..500,
Exon (1)1..74
Gene:MYL2
Gene Synonym:CMH10; MLC2
Exon (2)75..164
Gene:MYL2
Gene Synonym:CMH10; MLC2
Exon (3)165..240
Gene:MYL2
Gene Synonym:CMH10; MLC2
Exon (4)241..345
Gene:MYL2
Gene Synonym:CMH10; MLC2
Exon (5)346..424
Gene:MYL2
Gene Synonym:CMH10; MLC2
Exon (6)425..473
Gene:MYL2
Gene Synonym:CMH10; MLC2
Exon (7)474..830
Gene:MYL2
Gene Synonym:CMH10; MLC2
Translation MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR EMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(1)-dbSNP:
complement(1)-c, adbSNP:185700670
complement(42)-g, cdbSNP:2857718
complement(68)-t, cdbSNP:11538904
complement(104)-dbSNP:
complement(104)-t, cdbSNP:199742269
complement(107)-g, adbSNP:139794370
complement(108)-g, adbSNP:104894363
complement(123)-t, cdbSNP:104894370
complement(129)-c, adbSNP:199474816
complement(130)-g, adbSNP:113167834
complement(135)-g, adbSNP:104894368
complement(203)-dbSNP:
complement(203)-t, cdbSNP:2301610
complement(206)-t, cdbSNP:199474807
complement(212)-c, adbSNP:199474808
complement(240)-g, cdbSNP:2428140
complement(241)-dbSNP:
complement(241)-g, adbSNP:199474809
complement(244)-g, adbSNP:104894369
complement(245..246)-, ctdbSNP:35049558
complement(255)-t, adbSNP:201728041
complement(311)-t, adbSNP:35714558
complement(327)-g, adbSNP:138254843
complement(350)-dbSNP:
complement(350)-t, cdbSNP:28645088
complement(354)-g, cdbSNP:121913658
complement(381)-g, adbSNP:199474811
complement(413)-t, cdbSNP:199572927
complement(430)-dbSNP:
complement(430)-t, cdbSNP:192057022
complement(446)-t, cdbSNP:190020833
complement(451)-g, adbSNP:141878747
complement(452)-g, adbSNP:2233261
complement(472)-t, gdbSNP:143139258
complement(489)-dbSNP:
complement(489)-g, adbSNP:4683
complement(504)-t, cdbSNP:199567559
complement(527)-g, adbSNP:199815885
complement(530)-g, cdbSNP:149078011
complement(539)-t, cdbSNP:137984206
complement(555)-g, adbSNP:199474814
complement(568)-t, adbSNP:199474815
complement(582)-t, cdbSNP:193922452
complement(583)-t, cdbSNP:145437002
complement(590)-g, cdbSNP:2857716
complement(591)-g, cdbSNP:2520215
complement(602)-t, cdbSNP:201099141
complement(626)-t, cdbSNP:1803295
complement(632)-t, gdbSNP:187600820
complement(654)-t, gdbSNP:14881
complement(689)-t, gdbSNP:192821062
complement(708)-t, cdbSNP:14880
complement(751)-t, cdbSNP:1803294
complement(800)-t, cdbSNP:182109599
complement(803..804)-, tdbSNP:35115498
complement(807)-, adbSNP:35511065
Gene SymbolMYL2
Gene SynonymCMH10; MLC2
Chromosome12
Locus Map12q24.11
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000432 Homo sapiens myosin, light chain 2, regulatory, cardiac, slow (MYL2), mRNA. Full Length $247.95
ORF Sequence $159.00
Title AMPK regulates mitotic spindle orientation through phosphorylation of myosin regulatory light chain .
Author Thaiparambil,J.T., Eggers,C.M. and Marcus,A.I.
Journal Mol. Cell. Biol. 32 (16), 3203-3217 (2012)
Title Gene duplication and conversion events shaped three homologous, differentially expressed myosin regulatory light chain (MLC2) genes .
Author Gerrits,L., Overheul,G.J., Derks,R.C., Wieringa,B., Hendriks,W.J. and Wansink,D.G.
Journal Eur. J. Cell Biol. 91 (8), 629-639 (2012)
Title Myosin regulatory light chain mutation found in hypertrophic cardiomyopathy patients increases isometric force production in transgenic mice .
Author Kazmierczak,K., Muthu,P., Huang,W., Jones,M., Wang,Y. and Szczesna-Cordary,D.
Journal Biochem. J. 442 (1), 95-103 (2012)
Title Smooth muscle myosin light chain kinase efficiently phosphorylates serine 15 of cardiac myosin regulatory light chain .
Author Josephson,M.P., Sikkink,L.A., Penheiter,A.R., Burghardt,T.P. and Ajtai,K.
Journal Biochem. Biophys. Res. Commun. 416 (3-4), 367-371 (2011)
Title Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits .
Author Kim,Y.J., Go,M.J., Hu,C., Hong,C.B., Kim,Y.K., Lee,J.Y., Hwang,J.Y., Oh,J.H., Kim,D.J., Kim,N.H., Kim,S., Hong,E.J., Kim,J.H., Min,H., Kim,Y., Zhang,R., Jia,W., Okada,Y., Takahashi,A., Kubo,M., Tanaka,T., Kamatani,N., Matsuda,K., Park,T., Oh,B., Kimm,K., Kang,D., Shin,C., Cho,N.H., Kim,H.L., Han,B.G., Lee,J.Y. and Cho,Y.S.
Journal Nat. Genet. 43 (10), 990-995 (2011)
Title Mutations in either the essential or regulatory light chains of myosin are associated with a rare myopathy in human heart and skeletal muscle .
Author Poetter,K., Jiang,H., Hassanzadeh,S., Master,S.R., Chang,A., Dalakas,M.C., Rayment,I., Sellers,J.R., Fananapazir,L. and Epstein,N.D.
Journal Nat. Genet. 13 (1), 63-69 (1996)
Title The major protein expression profile and two-dimensional protein database of human heart .
Author Kovalyov,L.I., Shishkin,S.S., Efimochkin,A.S., Kovalyova,M.A., Ershova,E.S., Egorov,T.A. and Musalyamov,A.K.
Journal Electrophoresis 16 (7), 1160-1169 (1995)
Title Interaction of a conserved peptide domain in recombinant human ventricular myosin light chain-2 with myosin heavy chain .
Author Wadgaonkar,R., Shafiq,S., Rajmanickam,C. and Siddiqui,M.A.
Journal Cell. Mol. Biol. Res. 39 (1), 13-26 (1993)
Title Localization of the gene coding for ventricular myosin regulatory light chain (MYL2) to human chromosome 12q23-q24.3 .
Author Macera,M.J., Szabo,P., Wadgaonkar,R., Siddiqui,M.A. and Verma,R.S.
Journal Genomics 13 (3), 829-831 (1992)
Title Isolation and nucleotide sequence of the cDNA encoding human ventricular myosin light chain 2 .
Author Dalla Libera,L., Hoffmann,E., Floroff,M. and Jackowski,G.
Journal Nucleic Acids Res. 17 (6), 2360 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878