• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens notch 3 (NOTCH3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000435 Homo sapiens notch 3 (NOTCH3), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_000435.2, 134244284
Length 8089 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens notch 3 (NOTCH3), mRNA.
Product neurogenic locus notch homolog protein 3 precursor
Comment

Summary: This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL). [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments.

RefSeq NP_000426.2
CDS 77..7042
Misc Feature(1)548..661
Misc Feature(2)order(548..550,557..559,602..604)
Misc Feature(3)782..892
Misc Feature(4)order(782..784,791..793,833..835)
Misc Feature(5)896..1009
Misc Feature(6)order(896..898,905..907,953..955)
Misc Feature(7)1016..1123
Misc Feature(8)order(1016..1018,1025..1027,1067..1069)
Misc Feature(9)1247..1363
Misc Feature(10)order(1247..1249,1256..1258,1304..1306)
Misc Feature(11)1367..1477
Misc Feature(12)order(1367..1369,1376..1378,1418..1420)
Misc Feature(13)1481..1591
Misc Feature(14)order(1481..1483,1490..1492,1532..1534)
Misc Feature(15)1595..1702
Misc Feature(16)order(1595..1597,1604..1606,1646..1648)
Misc Feature(17)1709..1816
Misc Feature(18)order(1709..1711,1718..1720,1757..1759)
Misc Feature(19)1823..1930
Misc Feature(20)order(1829..1831,1871..1873)
Misc Feature(21)1934..2038
Misc Feature(22)order(1934..1936,1943..1945,1982..1984)
Misc Feature(23)2048..>2134
Misc Feature(24)order(2054..2056,2096..2098)
Misc Feature(25)2504..2614
Misc Feature(26)order(2504..2506,2513..2515,2558..2560)
Misc Feature(27)2621..2728
Misc Feature(28)order(2621..2623,2630..2632,2672..2674)
Misc Feature(29)2735..2842
Misc Feature(30)order(2735..2737,2744..2746,2783..2785)
Misc Feature(31)2861..2956
Misc Feature(32)3329..3436
Misc Feature(33)order(3335..3337,3377..3379)
Misc Feature(34)3440..3550
Misc Feature(35)order(3440..3442,3449..3451,3491..3493)
Misc Feature(36)3587..3685
Misc Feature(37)4214..4327
Misc Feature(38)4235..4357
Misc Feature(39)4337..4450
Misc Feature(40)4358..4450
Misc Feature(41)4475..4591
Misc Feature(42)4487..4576
Misc Feature(43)4589..4756
Misc Feature(44)4787..4792
Misc Feature(45)4802..4993
Misc Feature(46)4958..4960
Misc Feature(47)5006..5068
Misc Feature(48)5057..5059
Misc Feature(49)<5405..5755
Misc Feature(50)<5411..5752
Misc Feature(51)5588..5677
Misc Feature(52)5672..6052
Misc Feature(53)5687..5779
Misc Feature(54)5789..5878
Misc Feature(55)5804..6082
Misc Feature(56)5888..5977
Misc Feature(57)5987..6076
Misc Feature(58)6707..6895
Exon (1)1..194
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (2)195..273
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (3)274..416
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (4)417..755
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (5)756..878
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (6)879..1112
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (7)1113..1268
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (8)1269..1454
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (9)1455..1568
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (10)1569..1682
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (11)1683..1916
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (12)1917..2027
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (13)2028..2220
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (14)2221..2372
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (15)2373..2486
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (16)2487..2642
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (17)2643..2868
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (18)2869..3070
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (19)3071..3218
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (20)3219..3403
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (21)3404..3536
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (22)3537..3794
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (23)3795..3913
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (24)3914..4479
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (25)4480..4812
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (26)4813..4967
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (27)4968..5190
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (28)5191..5275
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (29)5276..5438
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (30)5439..5743
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (31)5744..5891
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (32)5892..5989
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Exon (33)5990..8071
Gene:NOTCH3
Gene Synonym:CADASIL; CASIL; IMF2
Translation MGPGARGRRRRRRPMSPPPPPPPVRALPLLLLLAGPGAAAPPCLDGSPCANGGRCTQLPS REAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLP DPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGS FRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDC PGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSC VCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPC HEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCG RGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVN GGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGT LCDRNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDL VDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINE CASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCVC EPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTPNPC EHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGG YTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSNPCGPGT CTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQ HEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRCVQTGA YCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGRTGSH CEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSCIDL VARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGL RCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQ CRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQTPRGPRCACPPGLS GPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFFRCACAQGWTGPRCEAPAAAPE VSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNS RCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC ASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHR PSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERL DFPYPLRDVRGEPLEPPEPSVPLLPLLVAGAVLLLVILVLGVMVARRKREHSTLWFPEGF SLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMG AEEAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCG GALEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLD AGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEG MVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAA REGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLG PLLCPPGAFLPGLKAAQSGSKKSRRPPGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLS PVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGRQPPGGCVLSL GLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEE YPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAM ATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(196)-dbSNP:
complement(196)-g, cdbSNP:146904189
complement(200)-g, cdbSNP:372995747
complement(209)-g, cdbSNP:142031490
complement(211)-g, adbSNP:370177269
222+g, tdbSNP:193921045
complement(230)-t, cdbSNP:148166997
complement(256)-g, adbSNP:143639330
complement(257)-g, adbSNP:200595885
complement(267)-t, gdbSNP:148932488
complement(279)-dbSNP:
complement(279)-g, adbSNP:146810942
289+g, tdbSNP:28937321
complement(300)-t, cdbSNP:145069047
complement(352)-g, adbSNP:140339246
complement(374)-t, cdbSNP:369361948
complement(379)-g, adbSNP:3815188
complement(414)-t, cdbSNP:143385744
complement(427)-dbSNP:
complement(427)-g, adbSNP:200881673
complement(466)-g, adbSNP:139597834
473+c, tdbSNP:137852642
complement(474)-t, cdbSNP:151016108
complement(499)-g, adbSNP:116044239
complement(527)-g, cdbSNP:371491165
complement(543)-t, cdbSNP:142492710
complement(563)-g, adbSNP:367707092
complement(575)-g, adbSNP:202157633
581+c, tdbSNP:28933696
complement(585)-t, cdbSNP:147373451
complement(612)-c, adbSNP:142778401
620+c, tdbSNP:28933697
complement(667)-g, adbSNP:367943979
complement(668)-t, cdbSNP:375682932
complement(669)-g, adbSNP:140914494
682+a, gdbSNP:1043994
complement(700)-g, adbSNP:368179321
complement(706)-g, cdbSNP:61336539
complement(724)-g, adbSNP:368662463
complement(736)-g, adbSNP:114457076
complement(778)-dbSNP:
complement(778)-t, gdbSNP:199663038
complement(785)-t, cdbSNP:2285981
complement(790)-g, adbSNP:138307755
complement(816)-t, cdbSNP:150491687
complement(819)-c, adbSNP:141402160
complement(830)-t, cdbSNP:115836330
complement(847)-t, gdbSNP:373744631
852+g, tdbSNP:75556687
complement(901)-dbSNP:
complement(901)-t, cdbSNP:138837495
complement(907)-t, cdbSNP:145049433
complement(926)-t, g, cdbSNP:149307620
complement(957)-g, adbSNP:146578114
complement(960)-c, adbSNP:143117018
1000+c, tdbSNP:1043995
complement(1021)-g, adbSNP:116239440
complement(1022)-t, cdbSNP:200517339
complement(1040)-t, cdbSNP:115029695
complement(1048)-g, adbSNP:149725987
complement(1049)-g, adbSNP:139559835
complement(1058)-t, gdbSNP:199878588
1070+c, tdbSNP:137852641
complement(1072)-g, adbSNP:183500505
complement(1100)-t, cdbSNP:373870097
complement(1120)-dbSNP:
complement(1120)-c, adbSNP:201033294
complement(1216)-t, g, c, adbSNP:61749020
complement(1227)-g, adbSNP:201917592
complement(1251)-t, adbSNP:377094060
complement(1265)-t, cdbSNP:147782884
complement(1267)-g, adbSNP:144214159
complement(1270)-dbSNP:
complement(1270)-g, adbSNP:140368657
1358+a, tdbSNP:267606915
complement(1396)-g, adbSNP:377548934
1439+c, tdbSNP:28933698
complement(1451)-t, cdbSNP:370186772
complement(1542)-dbSNP:
complement(1542)-t, cdbSNP:376728138
complement(1545)-g, cdbSNP:374248747
complement(1563)-g, adbSNP:11670799
complement(1566)-g, adbSNP:114207045
1570+dbSNP:
1570+c, tdbSNP:142762020
1576+c, tdbSNP:146055867
complement(1621)-g, cdbSNP:144837540
complement(1695)-dbSNP:
complement(1695)-g, adbSNP:200317373
complement(1696)-c, adbSNP:75617410
complement(1706)-g, adbSNP:201118034
complement(1712)-t, cdbSNP:376606994
complement(1717)-g, adbSNP:202039658
1748+a, gdbSNP:75068032
complement(1753)-g, adbSNP:113216024
complement(1754)-t, cdbSNP:200160665
complement(1766)-t, cdbSNP:374767079
complement(1768)-g, adbSNP:372158498
complement(1800)-g, adbSNP:371176740
1801+a, c, g, tdbSNP:79926127
complement(1805)-t, cdbSNP:368181126
complement(1825)-t, cdbSNP:373985781
complement(1828)-g, adbSNP:201207820
complement(1836)-t, cdbSNP:142787620
complement(1858)-g, adbSNP:35793356
complement(1930)-dbSNP:
complement(1930)-t, cdbSNP:150438748
complement(1993)-t, gdbSNP:371526861
complement(1995)-t, cdbSNP:377689004
complement(1996)-g, adbSNP:140818133
complement(2007)-t, adbSNP:148046938
complement(2020)-g, adbSNP:375012721
complement(2075)-dbSNP:
complement(2075)-t, cdbSNP:376046941
complement(2076)-t, cdbSNP:370386680
complement(2080)-t, cdbSNP:367768759
complement(2095)-t, cdbSNP:373603087
complement(2115)-t, cdbSNP:10406745
complement(2128)-t, cdbSNP:141399324
complement(2146)-t, cdbSNP:370780913
complement(2160)-g, adbSNP:202228716
complement(2213)-g, adbSNP:147855256
complement(2218)-t, gdbSNP:369579579
complement(2225)-dbSNP:
complement(2225)-g, adbSNP:144163298
complement(2239)-t, cdbSNP:375173938
complement(2251)-g, adbSNP:141993521
complement(2259)-t, cdbSNP:144935367
complement(2271)-g, cdbSNP:114499400
complement(2278)-g, adbSNP:140040122
complement(2302)-t, cdbSNP:79471197
complement(2311)-g, adbSNP:190937435
complement(2325)-t, cdbSNP:370975434
complement(2330)-t, cdbSNP:377521258
complement(2336)-t, cdbSNP:373142519
complement(2352)-g, adbSNP:139353527
complement(2358)-g, adbSNP:150866973
complement(2359)-t, cdbSNP:200424369
complement(2376)-dbSNP:
complement(2376)-t, cdbSNP:75291244
complement(2395)-g, adbSNP:182623173
complement(2478..2479)-, tdbSNP:35308509
complement(2508)-dbSNP:
complement(2508)-g, adbSNP:373367879
complement(2512)-g, adbSNP:369733076
complement(2513)-t, cdbSNP:375873637
complement(2526)-g, adbSNP:142405648
complement(2551)-g, adbSNP:372461266
complement(2575)-g, adbSNP:369602372
complement(2583)-g, adbSNP:34338511
complement(2606)-g, adbSNP:375223296
2614+c, tdbSNP:1043996
complement(2621)-c, adbSNP:142748631
complement(2622)-t, cdbSNP:368231434
complement(2642)-t, c, adbSNP:113142241
complement(2656)-dbSNP:
complement(2656)-g, adbSNP:201436750
complement(2758)-g, adbSNP:138245070
complement(2760)-g, adbSNP:144732188
complement(2800)-g, adbSNP:61731967
complement(2814)-g, adbSNP:370422650
2818+a, gdbSNP:1043997
complement(2825)-g, cdbSNP:150338460
complement(2849)-g, cdbSNP:184033385
complement(2880)-dbSNP:
complement(2880)-t, cdbSNP:201147300
complement(2898)-t, adbSNP:369213416
complement(2911)-t, cdbSNP:141346023
complement(2963)-t, cdbSNP:199978689
complement(2966)-g, cdbSNP:201336164
complement(2969)-g, adbSNP:138910710
complement(2982)-t, cdbSNP:146214060
complement(3008)-t, gdbSNP:141956294
complement(3014)-c, adbSNP:376187165
3017+c, tdbSNP:143695196
complement(3046)-t, cdbSNP:192400490
complement(3054)-g, adbSNP:371278091
complement(3058)-g, adbSNP:367700473
complement(3093)-dbSNP:
complement(3093)-t, cdbSNP:150941674
complement(3116)-g, cdbSNP:376682593
complement(3134)-g, cdbSNP:35769976
3159+g, tdbSNP:146829488
complement(3196)-g, adbSNP:372688320
complement(3224)-dbSNP:
complement(3224)-g, adbSNP:371525707
complement(3225)-t, cdbSNP:367923081
complement(3231)-t, cdbSNP:200822505
complement(3246)-g, adbSNP:368146879
complement(3286)-g, adbSNP:202041210
complement(3345)-g, adbSNP:200660191
complement(3369)-t, gdbSNP:182238142
complement(3375)-t, cdbSNP:189545202
complement(3381)-t, adbSNP:148838056
complement(3383)-t, cdbSNP:370829581
complement(3387)-t, cdbSNP:145524535
complement(3390)-g, cdbSNP:143764521
complement(3416)-dbSNP:
complement(3416)-g, adbSNP:199511490
complement(3428)-t, adbSNP:376950447
complement(3440)-t, cdbSNP:140147764
3448+c, tdbSNP:140642726
complement(3475)-t, g, cdbSNP:112197217
complement(3480)-g, cdbSNP:200723425
complement(3497)-t, cdbSNP:373181668
complement(3503)-g, adbSNP:60373464
complement(3504)-t, cdbSNP:144559574
complement(3531)-g, adbSNP:371437217
complement(3539)-dbSNP:
complement(3539)-, cdbSNP:34314808
complement(3568)-g, adbSNP:377218877
complement(3571)-g, adbSNP:373859689
complement(3588)-t, adbSNP:200072659
complement(3599)-g, adbSNP:200504060
complement(3613)-g, adbSNP:201850321
complement(3622)-g, adbSNP:369086257
complement(3623)-t, cdbSNP:10408676
complement(3636)-t, cdbSNP:199539384
complement(3644)-g, adbSNP:377099118
complement(3645)-t, cdbSNP:372241697
complement(3651)-g, adbSNP:150811543
complement(3696)-t, cdbSNP:141418355
complement(3705)-t, cdbSNP:35031555
complement(3715)-g, adbSNP:374239471
complement(3718)-g, adbSNP:78985996
complement(3734)-g, adbSNP:115872852
complement(3735)-t, cdbSNP:370233852
complement(3740)-c, adbSNP:199638166
complement(3752)-g, adbSNP:200842390
complement(3758)-t, cdbSNP:142798406
complement(3767)-g, adbSNP:201680145
complement(3780)-t, adbSNP:55882518
complement(3801)-dbSNP:
complement(3801)-t, cdbSNP:146149484
complement(3827)-t, cdbSNP:369213011
complement(3832)-g, adbSNP:377556280
complement(3853)-g, adbSNP:374265188
complement(3861)-t, cdbSNP:143684274
complement(3870)-g, adbSNP:138092938
complement(4003)-dbSNP:
complement(4003)-g, cdbSNP:61750057
4120+a, c, g, tdbSNP:78926093
4393+a, gdbSNP:76555145
complement(4409)-c, adbSNP:377578886
complement(4424)-t, cdbSNP:201082692
complement(4441)-g, adbSNP:191092115
complement(4450)-g, adbSNP:150288106
complement(4468)-g, cdbSNP:186300168
complement(4480)-dbSNP:
complement(4480)-g, adbSNP:145425679
complement(4520)-g, cdbSNP:202085803
complement(4610)-t, cdbSNP:375087797
complement(4628)-t, gdbSNP:141320511
4632+c, tdbSNP:367543285
complement(4636)-c, adbSNP:370010007
4639+a, gdbSNP:1044006
complement(4645)-t, cdbSNP:371994968
complement(4691)-g, adbSNP:144708461
complement(4703)-g, adbSNP:111838442
complement(4715)-g, cdbSNP:150037063
complement(4720)-g, adbSNP:112269053
complement(4755)-g, cdbSNP:78501403
complement(4797)-g, adbSNP:367924801
complement(4801)-t, gdbSNP:374042078
complement(4869)-dbSNP:
complement(4869)-t, adbSNP:201167365
complement(4934)-g, adbSNP:144401090
complement(4945)-g, cdbSNP:148574670
complement(4974)-dbSNP:
complement(4974)-g, adbSNP:375474414
complement(4975)-g, cdbSNP:200797732
4990+a, gdbSNP:149222385
complement(5011)-t, adbSNP:111706798
complement(5035)-c, adbSNP:74954563
complement(5155)-c, adbSNP:112441254
complement(5171)-g, adbSNP:142884248
complement(5200)-dbSNP:
complement(5200)-g, adbSNP:149766864
5205+a, gdbSNP:143411026
complement(5284)-dbSNP:
complement(5284)-g, cdbSNP:200331646
complement(5305)-t, cdbSNP:199684119
complement(5338)-g, adbSNP:181150285
complement(5362)-c, adbSNP:370274356
complement(5395)-g, adbSNP:115262182
complement(5396)-t, cdbSNP:143939165
complement(5399)-t, cdbSNP:139983430
complement(5446)-dbSNP:
complement(5446)-g, adbSNP:35887416
complement(5452)-t, cdbSNP:374875084
complement(5476)-c, adbSNP:34480308
complement(5536)-t, gdbSNP:114661066
complement(5542)-g, adbSNP:148053028
complement(5548)-g, cdbSNP:372950267
complement(5577)-t, cdbSNP:202027632
complement(5584)-g, adbSNP:142343505
complement(5585)-t, gdbSNP:143617599
complement(5586)-t, cdbSNP:138265894
complement(5588)-t, cdbSNP:376107735
complement(5593)-g, adbSNP:138411053
complement(5602)-g, adbSNP:16980398
complement(5627)-g, adbSNP:376590511
complement(5646)-t, cdbSNP:200883235
complement(5670)-g, adbSNP:369079257
complement(5680)-t, cdbSNP:140852427
complement(5701)-g, adbSNP:200103009
complement(5717)-t, gdbSNP:76166518
complement(5718..5719)-, ggggdbSNP:143171377
complement(5754)-dbSNP:
complement(5754)-t, cdbSNP:372834264
complement(5760)-c, adbSNP:369768722
complement(5801)-t, cdbSNP:374743270
complement(5835)-t, cdbSNP:201071248
complement(5840)-c, adbSNP:114813086
complement(5854)-g, adbSNP:374919430
complement(5930)-dbSNP:
complement(5930)-t, cdbSNP:115582213
complement(5955)-t, cdbSNP:370239685
complement(5971)-t, cdbSNP:140567100
complement(5976)-g, adbSNP:377589088
complement(5977)-c, adbSNP:373866355
complement(6014)-dbSNP:
complement(6014)-t, cdbSNP:367885841
complement(6017)-g, adbSNP:200541224
complement(6068)-g, adbSNP:201105335
complement(6086)-g, adbSNP:370927186
complement(6092)-t, adbSNP:375674115
complement(6101)-g, adbSNP:151322770
complement(6102)-t, cdbSNP:372627766
6107+a, gdbSNP:142007575
complement(6137)-t, cdbSNP:199620476
complement(6148)-t, cdbSNP:376463921
complement(6173)-t, gdbSNP:375213868
6174+c, tdbSNP:145859816
complement(6178)-g, adbSNP:114887570
complement(6182)-, gdbSNP:139374968
complement(6278)-t, cdbSNP:189252435
complement(6297)-g, adbSNP:114447350
complement(6313)-t, cdbSNP:376598183
complement(6314)-g, cdbSNP:113178142
6318+g, tdbSNP:141231747
complement(6376)-t, cdbSNP:183839795
complement(6401)-g, adbSNP:199995195
complement(6410)-t, cdbSNP:372833545
6514+a, gdbSNP:1044008
complement(6596)-g, adbSNP:376494303
complement(6599)-t, gdbSNP:372234123
complement(6679)-g, adbSNP:200415679
complement(6687)-g, adbSNP:371738874
complement(6700)-g, adbSNP:146679327
complement(6708)-t, cdbSNP:369813654
6744+c, tdbSNP:1044009
complement(6745)-c, adbSNP:191173559
complement(6772)-t, cdbSNP:12976268
complement(6776)-g, adbSNP:184996545
complement(6829)-g, c, adbSNP:61731975
complement(6831)-t, gdbSNP:201073642
complement(6885)-g, adbSNP:148716935
complement(6886)-t, cdbSNP:147655727
complement(6889)-g, adbSNP:61731974
complement(6941)-g, cdbSNP:79447691
complement(6947)-t, gdbSNP:139941570
complement(7009)-t, cdbSNP:367934317
complement(7045)-g, adbSNP:202157455
complement(7046)-t, cdbSNP:182111655
complement(7058)-g, adbSNP:373630893
complement(7065)-t, adbSNP:73504084
complement(7120)-g, adbSNP:190171436
complement(7127)-c, adbSNP:185310376
complement(7138)-g, adbSNP:117165744
complement(7348)-g, adbSNP:181930934
complement(7380)-t, gdbSNP:7247906
complement(7386..7387)-, aadbSNP:59869411
complement(7412)-t, cdbSNP:139792065
complement(7505)-t, cdbSNP:145095999
complement(7530)-g, adbSNP:372607689
complement(7586)-g, adbSNP:368577217
complement(7605)-t, g, adbSNP:77669983
complement(7610)-g, adbSNP:374751999
complement(7627)-c, adbSNP:79794352
7651+g, tdbSNP:1804976
7710+g, tdbSNP:1044055
complement(7715)-t, cdbSNP:189969877
complement(7721)-g, adbSNP:371016478
complement(7759)-g, adbSNP:3087938
complement(7815..7816)-, cdbSNP:34134952
7850+a, gdbSNP:1044116
7879+a, gdbSNP:12082
7932+c, tdbSNP:1044123
complement(7979)-g, adbSNP:16980378
complement(7987)-, tdbSNP:34925770
Gene SymbolNOTCH3
Gene SynonymCADASIL; CASIL; IMF2
Chromosome19
Locus Map19p13.2-p13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000435 Homo sapiens notch 3 (NOTCH3), mRNA. On-demand TBD TBD
XM_005259924 PREDICTED: Homo sapiens notch 3 (NOTCH3), transcript variant X1, mRNA. On-demand TBD TBD
Title Par-4/THAP1 complex and Notch3 competitively regulated pre-mRNA splicing of CCAR1 and affected inversely the survival of T-cell acute lymphoblastic leukemia cells .
Author Lu C, Li JY, Ge Z, Zhang L and Zhou GP.
Journal Oncogene 32 (50), 5602-5613 (2013)
Title Novel MIR143-NOTCH fusions in benign and malignant glomus tumors .
Author Mosquera JM, Sboner A, Zhang L, Chen CL, Sung YS, Chen HW, Agaram NP, Briskin D, Basha BM, Singer S, Rubin MA, Tuschl T and Antonescu CR.
Journal Genes Chromosomes Cancer 52 (11), 1075-1087 (2013)
Title Notch signaling mediates melanoma-endothelial cell communication and melanoma cell migration .
Author Howard JD, Moriarty WF, Park J, Riedy K, Panova IP, Chung CH, Suh KY, Levchenko A and Alani RM.
Journal Pigment Cell Melanoma Res 26 (5), 697-707 (2013)
Title A rare population of CD24(+)ITGB4(+)Notch(hi) cells drives tumor propagation in NSCLC and requires Notch3 for self-renewal .
Author Zheng Y, de la Cruz CC, Sayles LC, Alleyne-Chin C, Vaka D, Knaak TD, Bigos M, Xu Y, Hoang CD, Shrager JB, Fehling HJ, French D, Forrest W, Jiang Z, Carano RA, Barck KH, Jackson EL and Sweet-Cordero EA.
Journal Cancer Cell 24 (1), 59-74 (2013)
Title Aberrant expression of Notch3 predicts poor survival for hepatocellular carcinomas .
Author Hu L, Xue F, Shao M, Deng A and Wei G.
Journal Biosci Trends 7 (3), 152-156 (2013)
Title The human NOTCH1, 2, and 3 genes are located at chromosome positions 9q34, 1p13-p11, and 19p13.2-p13.1 in regions of neoplasia-associated translocation .
Author Larsson C, Lardelli M, White I and Lendahl U.
Journal Genomics 24 (2), 253-258 (1994)
Title Three genes in the human MHC class III region near the junction with the class II: gene for receptor of advanced glycosylation end products, PBX2 homeobox gene and a notch homolog, human counterpart of mouse mammary tumor gene int-3 .
Author Sugaya K, Fukagawa T, Matsumoto K, Mita K, Takahashi E, Ando A, Inoko H and Ikemura T.
Journal Genomics 23 (2), 408-419 (1994)
Title Cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy maps to chromosome 19q12 .
Author Tournier-Lasserve E, Joutel A, Melki J, Weissenbach J, Lathrop GM, Chabriat H, Mas JL, Cabanis EA, Baudrimont M and Maciazek J.
Journal Nat. Genet. 3 (3), 256-259 (1993)
Title CADASIL .
Author Lesnik Oberstein,S.A.J., Boon,E.M.J. and Terwindt,G.M.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Comparison of male and female kidney transplant survival rates .
Author Beleil,O.M., Mickey,M.R. and Terasaki,P.I.
Journal Transplantation 13 (5), 493-500 (1972)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.