• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000442 Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_000442.4, 313760623
Length 6831 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), mRNA.
Product platelet endothelial cell adhesion molecule precursor
Comment

Summary: The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation. [provided by RefSeq, May 2010].


Sequence Note: Due to a gap in the GRCh37 reference genome sequence, only a portion of the 3'-most exon of NM_000442.4 aligns to the reference genome sequence.

RefSeq NP_000433.4
CDS 214..2430
Misc Feature(1)157..159
Misc Feature(2)319..594
Misc Feature(3)340..594
Misc Feature(4)1192..1425
Misc Feature(5)1738..1962
Misc Feature(6)2017..2073
Misc Feature(7)2281..2283
Misc Feature(8)2350..2352
Misc Feature(9)2374..2427
Translation MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFAD VSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTT AEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKRE KNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHI SPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNRHGNKAVYSVMAMVEHSG NYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIPGAPPANFTIQ KEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADN CHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREK EGKPFYQMTSNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWK KGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEAN SHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAV PDAVESRYSRTEGSLDGT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(62)-dbSNP:
complement(62)-t, cdbSNP:45465993
complement(62)-t, cdbSNP:201689392
complement(586)-g, cdbSNP:668
586+c, gdbSNP:281865545
complement(897)-g, adbSNP:118195022
complement(1013..1014)-, gdbSNP:36153854
complement(1198)-g, adbSNP:200623026
complement(1422)-t, cdbSNP:2229393
complement(1502)-g, adbSNP:199816177
complement(1506)-g, cdbSNP:13306812
complement(1665)-g, adbSNP:200756271
complement(1710)-t, cdbSNP:201830340
complement(1710)-g, adbSNP:35139902
complement(1752)-g, adbSNP:2229391
complement(1797)-c, adbSNP:11540684
complement(2141)-g, adbSNP:45552934
complement(2141)-g, adbSNP:200519538
complement(2154)-g, adbSNP:7211869
complement(2154)-g, adbSNP:200302794
complement(2391)-t, gdbSNP:187016261
complement(2475)-t, cdbSNP:59249661
complement(2488)-g, adbSNP:2812
complement(2534)-g, cdbSNP:191033438
complement(2574)-g, adbSNP:144700105
complement(2633)-t, gdbSNP:201183806
complement(2683)-g, adbSNP:35531906
complement(2691)-g, cdbSNP:114416047
complement(2702)-g, cdbSNP:111586323
complement(2711)-t, g, adbSNP:56074393
complement(2811)-t, gdbSNP:55744312
complement(2857)-t, gdbSNP:13306807
complement(2896)-g, cdbSNP:6809
complement(2925)-t, cdbSNP:180844687
complement(2945)-g, cdbSNP:56350444
complement(3004)-t, gdbSNP:2278680
complement(3031)-g, cdbSNP:6808
complement(3093)-c, adbSNP:14753
complement(3117)-t, adbSNP:11540685
complement(3193)-g, adbSNP:1050352
complement(3251)-c, adbSNP:115791711
complement(3259)-g, adbSNP:145257358
complement(3260)-t, cdbSNP:149976701
complement(3369)-g, cdbSNP:184657582
complement(3370)-t, cdbSNP:112650305
complement(3392)-g, adbSNP:1131107
complement(3518..3519)-, ct, cdbSNP:67208719
complement(3519..3520)-, cdbSNP:35975413
complement(3519)-t, cdbSNP:77067216
complement(3590)-t, cdbSNP:188835328
complement(3602..3606)-g, adbSNP:17072
complement(3602)-g, adbSNP:1050380
complement(3606)-t, cdbSNP:1050382
complement(3647)-t, cdbSNP:184001347
complement(3677)-g, adbSNP:41300622
complement(3686)-c, adbSNP:11540683
complement(3695)-t, cdbSNP:192564970
complement(3726..3727)-, aatdbSNP:201829217
complement(3734)-t, c, adbSNP:9902260
complement(3797)-g, cdbSNP:112361239
complement(3946)-t, adbSNP:188226968
complement(4001)-g, adbSNP:41307621
complement(4058)-t, cdbSNP:8076821
complement(4129)-t, cdbSNP:41306872
complement(4346)-g, cdbSNP:199815194
complement(4384)-g, cdbSNP:184539069
complement(4404)-t, cdbSNP:150894680
complement(4459)-t, cdbSNP:192642674
complement(4483)-t, cdbSNP:188029518
complement(4651)-, adbSNP:5821431
complement(4887)-g, adbSNP:71377739
complement(4942)-g, cdbSNP:183262180
complement(5038)-g, adbSNP:7213889
complement(5076)-t, g, cdbSNP:7214643
complement(5172)-g, adbSNP:190719039
complement(5253..5255)-, aaadbSNP:200837213
complement(5390)-t, cdbSNP:143945906
complement(5537)-t, cdbSNP:200411420
complement(5576)-c, adbSNP:116199208
complement(5703)-t, cdbSNP:140116981
complement(5820)-c, adbSNP:78022047
complement(5880)-t, gdbSNP:187350612
complement(5964)-g, adbSNP:146132570
complement(6176)-c, adbSNP:77648847
complement(6223)-t, gdbSNP:12948941
complement(6246)-t, cdbSNP:113717988
complement(6298)-t, cdbSNP:183299651
complement(6389)-t, adbSNP:117706775
complement(6430)-g, adbSNP:111718056
complement(6439)-g, adbSNP:147999588
complement(6449)-t, cdbSNP:186518004
complement(6547)-t, cdbSNP:144496789
complement(6584)-t, gdbSNP:182717346
complement(6720..6721)-, cdbSNP:35473152
complement(6761)-g, adbSNP:10785
Gene SymbolPECAM1
Gene SynonymCD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Chromosome17
Locus Map17q23.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000442 Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), mRNA. On-demand $849.00 20
Title Levels of soluble platelet endothelial cell adhesion molecule-1 and P-selectin are decreased in children with autism spectrum disorder .
Author Onore,C.E., Nordahl,C.W., Young,G.S., Van de Water,J.A., Rogers,S.J. and Ashwood,P.
Journal Biol. Psychiatry 72 (12), 1020-1025 (2012)
Title Platelet endothelial cell adhesion molecule-1 polymorphism in patients with bronchial asthma .
Author Nadi,E., Hajilooi,M., Babakhani,D. and Rafiei,A.
Journal Iran J Allergy Asthma Immunol 11 (4), 276-281 (2012)
Title CD31 immunohistochemical staining in Kaposi Sarcoma .
Author Pantanowitz,L., Moses,A.V. and Fruh,K.
Journal Arch. Pathol. Lab. Med. 136 (11), 1329 (2012)
Title Crosstalk between reticular adherens junctions and platelet endothelial cell adhesion molecule-1 regulates endothelial barrier function .
Author Fernandez-Martin,L., Marcos-Ramiro,B., Bigarella,C.L., Graupera,M., Cain,R.J., Reglero-Real,N., Jimenez,A., Cernuda-Morollon,E., Correas,I., Cox,S., Ridley,A.J. and Millan,J.
Journal Arterioscler. Thromb. Vasc. Biol. 32 (8), E90-E102 (2012)
Title Endothelial cell palmitoylproteomic identifies novel lipid-modified targets and potential substrates for protein acyl transferases .
Author Marin,E.P., Derakhshan,B., Lam,T.T., Davalos,A. and Sessa,W.C.
Journal Circ. Res. 110 (10), 1336-1344 (2012)
Title Organization of the gene for human platelet/endothelial cell adhesion molecule-1 shows alternatively spliced isoforms and a functionally complex cytoplasmic domain .
Author Kirschbaum,N.E., Gumina,R.J. and Newman,P.J.
Journal Blood 84 (12), 4028-4037 (1994)
Title Molecular and cellular properties of PECAM-1 (endoCAM/CD31): a novel vascular cell-cell adhesion molecule .
Author Albelda,S.M., Muller,W.A., Buck,C.A. and Newman,P.J.
Journal J. Cell Biol. 114 (5), 1059-1068 (1991)
Title Molecular characterization and functional analysis of the leukocyte surface protein CD31 .
Author Stockinger,H., Gadd,S.J., Eher,R., Majdic,O., Schreiber,W., Kasinrerk,W., Strass,B., Schnabl,E. and Knapp,W.
Journal J. Immunol. 145 (11), 3889-3897 (1990)
Title Molecular cloning of CD31, a putative intercellular adhesion molecule closely related to carcinoembryonic antigen .
Author Simmons,D.L., Walker,C., Power,C. and Pigott,R.
Journal J. Exp. Med. 171 (6), 2147-2152 (1990)
Title PECAM-1 (CD31) cloning and relation to adhesion molecules of the immunoglobulin gene superfamily .
Author Newman,P.J., Berndt,M.C., Gorski,J., White,G.C. II, Lyman,S., Paddock,C. and Muller,W.A.
Journal Science 247 (4947), 1219-1222 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.