• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000442 Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_000442.4, 313760623
Length 6831 bp
Structure linear
Update Date 06-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), mRNA.
Product platelet endothelial cell adhesion molecule precursor
Comment

Summary: The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation. [provided by RefSeq, May 2010].


Sequence Note: Due to a gap in the GRCh37 reference genome sequence, only a portion of the 3'-most exon of NM_000442.4 aligns to the reference genome sequence.

RefSeq NP_000433.4
CDS 214..2430
Misc Feature(1)157..159
Misc Feature(2)340..594
Misc Feature(3)340..594
Misc Feature(4)1192..1425
Misc Feature(5)1228..1377
Misc Feature(6)1732..1995
Misc Feature(7)1738..1962
Misc Feature(8)2017..2073
Misc Feature(9)2281..2283
Misc Feature(10)2350..2352
Misc Feature(11)2374..2427
Exon (1)1..277
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (2)278..304
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (3)305..598
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (4)599..904
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (5)905..1180
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (6)1181..1429
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (7)1430..1705
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (8)1706..1993
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (9)1994..2101
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (10)2102..2129
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (11)2130..2203
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (12)2204..2257
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (13)2258..2320
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (14)2321..2377
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (15)2378..2400
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Exon (16)2401..6831
Gene:PECAM1
Gene Synonym:CD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Translation MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFAD VSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTT AEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKRE KNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHI SPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNRHGNKAVYSVMAMVEHSG NYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIPGAPPANFTIQ KEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADN CHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREK EGKPFYQMTSNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWK KGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEAN SHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAV PDAVESRYSRTEGSLDGT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(62)-dbSNP:
complement(62)-t, cdbSNP:45465993
complement(315)-dbSNP:
complement(315)-t, gdbSNP:200425210
complement(586)-g, cdbSNP:668
complement(586)-g, cdbSNP:150163973
complement(897)-dbSNP:
complement(897)-g, adbSNP:118195022
complement(1198)-dbSNP:
complement(1198)-g, adbSNP:200623026
complement(1502)-dbSNP:
complement(1502)-g, adbSNP:199816177
1665+c, tdbSNP:1131010
1901+dbSNP:
1901+a, g, tdbSNP:12953
complement(2141)-dbSNP:
complement(2141)-g, adbSNP:45552934
2221+dbSNP:
2221+a, gdbSNP:1131012
complement(2378)-dbSNP:
complement(2378)-t, gdbSNP:368999530
complement(2391)-t, gdbSNP:187016261
complement(2399)-g, adbSNP:374641874
complement(2425)-dbSNP:
complement(2425)-t, adbSNP:376154013
complement(2475)-t, cdbSNP:59249661
2488+a, gdbSNP:2812
complement(2488)-t, cdbSNP:386574186
complement(2534)-g, cdbSNP:191033438
complement(2574)-g, adbSNP:144700105
complement(2633)-t, gdbSNP:201183806
complement(2683)-g, adbSNP:35531906
complement(2691)-g, cdbSNP:114416047
complement(2702)-g, cdbSNP:111586323
complement(2711)-t, g, adbSNP:56074393
complement(2777)-t, cdbSNP:368760272
complement(2811)-t, gdbSNP:55744312
2857+g, tdbSNP:13306807
complement(2857)-c, adbSNP:386528029
2896+c, gdbSNP:6809
complement(2925)-t, cdbSNP:180844687
complement(2945)-g, cdbSNP:56350444
3004+g, tdbSNP:2278680
3031+c, gdbSNP:6808
3093+a, cdbSNP:14753
3117+a, tdbSNP:11540685
3193+a, gdbSNP:1050352
complement(3251)-c, adbSNP:115791711
complement(3259)-g, adbSNP:145257358
complement(3260)-t, cdbSNP:149976701
complement(3369)-g, cdbSNP:184657582
complement(3370)-t, cdbSNP:112650305
3392+a, gdbSNP:1131107
complement(3519..3520)-, cdbSNP:35975413
complement(3519)-t, cdbSNP:77067216
complement(3590)-t, cdbSNP:188835328
complement(3602..3606)-g, adbSNP:17072
3602+a, gdbSNP:1050380
3606+c, tdbSNP:1050382
complement(3647)-t, cdbSNP:184001347
complement(3658)-, tdbSNP:371167647
complement(3677)-g, adbSNP:41300622
3686+a, cdbSNP:11540683
complement(3695)-t, cdbSNP:192564970
complement(3726..3727)-, aatdbSNP:201829217
complement(3734)-t, c, adbSNP:9902260
complement(3797)-g, cdbSNP:112361239
complement(3946)-t, adbSNP:188226968
complement(4001)-g, adbSNP:41307621
complement(4058)-t, cdbSNP:8076821
complement(4129)-t, cdbSNP:41306872
complement(4332)-t, cdbSNP:368413956
complement(4346)-g, cdbSNP:199815194
complement(4348)-g, adbSNP:267604996
complement(4384)-g, cdbSNP:184539069
complement(4404)-t, cdbSNP:150894680
complement(4459)-t, cdbSNP:192642674
complement(4483)-t, cdbSNP:188029518
complement(4651)-, adbSNP:5821431
complement(4887)-g, adbSNP:71377739
complement(4942)-g, cdbSNP:183262180
complement(5038)-g, adbSNP:7213889
complement(5076)-t, g, cdbSNP:7214643
complement(5076)-g, adbSNP:386421216
complement(5172)-g, adbSNP:190719039
complement(5253..5255)-, aaadbSNP:200837213
complement(5390)-t, cdbSNP:143945906
complement(5439)-t, gdbSNP:374537372
complement(5537)-t, cdbSNP:200411420
complement(5576)-c, adbSNP:116199208
complement(5606..5609)-, ctctdbSNP:372681660
complement(5703)-t, cdbSNP:140116981
complement(5820)-c, adbSNP:78022047
complement(5880)-t, gdbSNP:187350612
complement(5964)-g, adbSNP:146132570
complement(6176)-c, adbSNP:77648847
complement(6223)-t, gdbSNP:12948941
complement(6246)-t, cdbSNP:113717988
complement(6298)-t, cdbSNP:183299651
complement(6389)-t, adbSNP:117706775
complement(6430)-g, adbSNP:111718056
complement(6439)-g, adbSNP:147999588
complement(6449)-t, cdbSNP:186518004
complement(6547)-t, cdbSNP:144496789
complement(6584)-t, gdbSNP:182717346
complement(6718..6719)-, cdbSNP:35473152
complement(6761)-g, adbSNP:10785
Gene SymbolPECAM1
Gene SynonymCD31; CD31/EndoCAM; endoCAM; GPIIA'; PECA1; PECAM-1
Chromosome17
Locus Map17q23.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000442 Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), mRNA. On-demand $849.00 20
XM_006721944 PREDICTED: Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), transcript variant X6, mRNA. On-demand $849.00 20
XM_006721945 PREDICTED: Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), transcript variant X7, mRNA. On-demand $849.00 20
XM_005276880 PREDICTED: Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), transcript variant X2, mRNA. On-demand $849.00 20
XM_005276881 PREDICTED: Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), transcript variant X3, mRNA. On-demand $849.00 20
XM_005276882 PREDICTED: Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), transcript variant X4, mRNA. On-demand $849.00 20
XM_005276883 PREDICTED: Homo sapiens platelet/endothelial cell adhesion molecule 1 (PECAM1), transcript variant X5, mRNA. On-demand $849.00 20
Title The adaptor protein SAP directly associates with PECAM-1 and regulates PECAM-1-mediated-cell adhesion in T-like cell lines .
Author Proust R, Crouin C, Gandji LY, Bertoglio J and Gesbert F.
Journal Mol. Immunol. 58 (2), 206-213 (2014)
Title Expression of CD31/PECAM-1 (platelet endothelial cell adhesion molecule 1) by blastic plasmacytoid dendritic cell neoplasms .
Author Salva KA, Haemel AK, Pincus LB, Liu J, Sundram U, Guitart J, Longley BJ and Wood GS.
Journal JAMA Dermatol 150 (1), 73-76 (2014)
Title Platelet endothelial cell adhesion molecule 1 deficiency misguides venous thrombus resolution .
Author Kellermair J, Redwan B, Alias S, Jabkowski J, Panzenboeck A, Kellermair L, Winter MP, Weltermann A and Lang IM.
Journal Blood 122 (19), 3376-3384 (2013)
Title Antithrombotic actions of statins involve PECAM-1 signaling .
Author Moraes LA, Vaiyapuri S, Sasikumar P, Ali MS, Kriek N, Sage T and Gibbins JM.
Journal Blood 122 (18), 3188-3196 (2013)
Title Increased expression of VEGF and CD31 in postradiation rectal tissue: implications for radiation proctitis .
Author Karamanolis G, Delladetsima I, Kouloulias V, Papaxoinis K, Panayiotides I, Haldeopoulos D, Triantafyllou K, Kelekis N and Ladas SD.
Journal Mediators Inflamm. 2013, 515048 (2013)
Title Organization of the gene for human platelet/endothelial cell adhesion molecule-1 shows alternatively spliced isoforms and a functionally complex cytoplasmic domain .
Author Kirschbaum NE, Gumina RJ and Newman PJ.
Journal Blood 84 (12), 4028-4037 (1994)
Title Molecular and cellular properties of PECAM-1 (endoCAM/CD31): a novel vascular cell-cell adhesion molecule .
Author Albelda SM, Muller WA, Buck CA and Newman PJ.
Journal J. Cell Biol. 114 (5), 1059-1068 (1991)
Title Molecular characterization and functional analysis of the leukocyte surface protein CD31 .
Author Stockinger H, Gadd SJ, Eher R, Majdic O, Schreiber W, Kasinrerk W, Strass B, Schnabl E and Knapp W.
Journal J. Immunol. 145 (11), 3889-3897 (1990)
Title Molecular cloning of CD31, a putative intercellular adhesion molecule closely related to carcinoembryonic antigen .
Author Simmons DL, Walker C, Power C and Pigott R.
Journal J. Exp. Med. 171 (6), 2147-2152 (1990)
Title PECAM-1 (CD31) cloning and relation to adhesion molecules of the immunoglobulin gene superfamily .
Author Newman PJ, Berndt MC, Gorski J, White GC 2nd, Lyman S, Paddock C and Muller WA.
Journal Science 247 (4947), 1219-1222 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.