• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens recombination activating gene 1 (RAG1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu17854 Homo sapiens recombination activating gene 1 (RAG1), mRNA. pcDNA3.1+-DYK In-stock $1149.00 16
OHu17854C Homo sapiens recombination activating gene 1 (RAG1), mRNA. Customized vector In-stock $1149.00 16

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000448.2, 172072669
Length 3132 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens recombination activating gene 1 (RAG1), mRNA.
Product V(D)J recombination-activating protein 1
Comment

Summary: The protein encoded by this gene is involved in activation of immunoglobulin V-D-J recombination. The encoded protein is involved in recognition of the DNA substrate, but stable binding and cleavage activity also requires RAG2. Defects in this gene can be the cause of several diseases. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_000439.1
CDS 125..3256
Misc Feature(1)53..55
Misc Feature(2)125..988
Misc Feature(3)125..988
Misc Feature(4)1001..1129
Misc Feature(5)order(1001..1003,1010..1012,1046..1048,1052..1054,
Misc Feature(6)1184..1273
Misc Feature(7)1661..2983
Misc Feature(8)2810..2812
Exon (1)1..110
Gene:RAG1
Gene Synonym:RAG-1; RNF74
Exon (2)111..6582
Gene:RAG1
Gene Synonym:RAG-1; RNF74
Translation MAASFPPTLGLSSAPDEIQHPHIKFSEWKFKLFRVRSFEKTPEEAQKEKKDSFEGKPSLE QSPAVLDKADGQKPVPTQPLLKAHPKFSKKFHDNEKARGKAIHQANLRHLCRICGNSFRA DEHNRRYPVHGPVDGKTLGLLRKKEKRATSWPDLIAKVFRIDVKADVDSIHPTEFCHNCW SIMHRKFSSAPCEVYFPRNVTMEWHPHTPSCDICNTARRGLKRKSLQPNLQLSKKLKTVL DQARQARQRKRRAQARISSKDVMKKIANCSKIHLSTKLLAVDFPEHFVKSISCQICEHIL ADPVETNCKHVFCRVCILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLSVLNSLMVKCPA KECNEEVSLEKYNHHISSHKESKEIFVHINKGGRPRQHLLSLTRRAQKHRLRELKLQVKA FADKEEGGDVKSVCMTLFLLALRARNEHRQADELEAIMQGKGSGLQPAVCLAIRVNTFLS CSQYHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYHHFEWQPPLKNVSSSTDVGIIDG LSGLSSSVDDYPVDTIAKRFRYDSALVSALMDMEEDILEGMRSQDLDDYLNGPFTVVVKE SCDGMGDVSEKHGSGPVVPEKAVRFSFTIMKITIAHSSQNVKVFEEAKPNSELCCKPLCL MLADESDHETLTAILSPLIAEREAMKSSELMLELGGILRTFKFIFRGTGYDEKLVREVEG LEASGSVYICTLCDATRLEASQNLVFHSITRSHAENLERYEVWRSNPYHESVEELRDRVK GVSAKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKNPNASKEERKRWQATLDKHL RKKMNLKPIMRMNGNFARKLMTKETVDAVCELIPSEERHEALRELMDLYLKMKPVWRSSC PAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWA SEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQKFMNAHNALKTSGFTMN PQASLGDPLGIEDSLESQDSMEF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
11+dbSNP:
11+a, gdbSNP:872052
60+a, gdbSNP:872053
89+a, gdbSNP:367617621
125+a, gdbSNP:200575481
180+a, gdbSNP:150201913
184+c, tdbSNP:138801620
218+c, gdbSNP:149364682
223+a, cdbSNP:370678903
225+a, gdbSNP:377307948
275+g, tdbSNP:373615697
276+a, tdbSNP:147486240
310+g, tdbSNP:201625282
complement(313)-t, cdbSNP:34357808
318+c, tdbSNP:143654819
375+a, gdbSNP:150199231
381+a, tdbSNP:371433826
391+a, gdbSNP:267602869
406+c, tdbSNP:148700564
408+a, gdbSNP:142057334
419+a, gdbSNP:138676205
427+a, gdbSNP:4151025
442+a, cdbSNP:367725290
443+c, gdbSNP:144019501
445+g, tdbSNP:374971336
446+c, tdbSNP:193922464
458+c, tdbSNP:146457887
460..461+, cdbSNP:4151026
479+a, gdbSNP:371963186
540+g, tdbSNP:140648865
549+a, gdbSNP:372110434
556+g, tdbSNP:144430517
580+g, tdbSNP:368797111
591+c, tdbSNP:1801203
607+c, tdbSNP:372677584
630+c, tdbSNP:4151027
635+c, tdbSNP:377310123
637+c, gdbSNP:371145383
651+g, tdbSNP:149229197
666+g, tdbSNP:374362464
683+a, tdbSNP:377399061
701+c, tdbSNP:34841221
715+a, gdbSNP:370135440
721+c, tdbSNP:148288583
742+a, cdbSNP:200182366
753+c, tdbSNP:147440161
754+a, c, tdbSNP:4151028
775+c, tdbSNP:141561979
777+a, gdbSNP:202178215
779+c, tdbSNP:368199324
844+, tdbSNP:146046446
849+a, gdbSNP:76897604
854+a, gdbSNP:199474683
863+c, gdbSNP:147203889
864+a, gdbSNP:4151029
870+a, gdbSNP:3740955
875+a, gdbSNP:144616804
900+g, tdbSNP:368279695
913..915+, gaadbSNP:373344442
922+c, tdbSNP:141654332
923+a, gdbSNP:148393376
927+a, gdbSNP:372245240
939+a, tdbSNP:374454838
948+a, gdbSNP:368607209
964+a, gdbSNP:371467727
976+a, gdbSNP:374699389
1003+c, tdbSNP:188125314
1030+a, cdbSNP:4151030
1041+c, tdbSNP:145962212
1064+c, tdbSNP:121918568
1080+c, gdbSNP:139883723
1091+a, gdbSNP:144391165
1098+a, gdbSNP:201462389
1107+a, gdbSNP:121918571
1109+c, tdbSNP:181967562
1128+g, tdbSNP:371983072
1172+a, gdbSNP:200758244
1188+c, tdbSNP:151077440
1192+a, gdbSNP:375609144
1203+c, tdbSNP:376840051
1214+a, gdbSNP:369623707
1215+a, gdbSNP:186342720
1278+c, tdbSNP:141049427
1310+c, tdbSNP:104894289
1311+a, g, tdbSNP:104894291
1312+c, gdbSNP:371174980
1325+c, tdbSNP:199474682
1331+a, tdbSNP:202189218
1353+a, gdbSNP:199474684
1360+a, gdbSNP:373408080
1410+a, gdbSNP:104894292
1421+a, gdbSNP:199474679
1422+c, tdbSNP:376901369
1423+c, gdbSNP:145877904
1427+a, gdbSNP:141524540
1455+c, tdbSNP:199474685
1470+a, gdbSNP:4151031
1470+a, gdbSNP:386591598
1485+a, tdbSNP:199474677
1491+a, cdbSNP:201779957
1495+c, tdbSNP:138387845
1503+c, gdbSNP:191898756
1524+c, tdbSNP:142486791
1544+c, tdbSNP:199474678
1545+a, gdbSNP:199474686
1583+a, gdbSNP:112047157
1601+a, gdbSNP:374560352
1643+c, tdbSNP:104894298
1644+a, gdbSNP:143969029
1648+c, tdbSNP:370855517
1684+g, tdbSNP:61758790
1690+g, tdbSNP:193922461
1697+c, tdbSNP:4151032
1702+a, gdbSNP:143289774
1723+a, tdbSNP:367610139
1753+a, gdbSNP:17853743
1761+c, tdbSNP:148235228
1789+c, tdbSNP:141265699
1798+c, gdbSNP:150790148
1801+g, tdbSNP:199474681
1805+c, tdbSNP:104894285
1806+a, gdbSNP:104894284
1820+c, tdbSNP:369155853
1829+g, tdbSNP:138101978
1851+a, tdbSNP:142333735
1925+a, tdbSNP:145951370
1945+c, tdbSNP:183806098
1988+a, gdbSNP:148380512
1994+c, tdbSNP:199474688
1995+a, gdbSNP:199474680
2041+a, gdbSNP:144475142
2130+a, gdbSNP:199474689
2133+c, tdbSNP:139863630
2159+a, gdbSNP:143227621
2212+c, gdbSNP:144503943
2219+c, tdbSNP:199474676
2220+a, gdbSNP:369990217
2270+c, tdbSNP:199776076
2283+a, gdbSNP:374370400
2287+c, tdbSNP:369014366
2288+a, gdbSNP:28933392
2305+c, gdbSNP:148763154
2309+a, cdbSNP:201192233
2334+a, gdbSNP:104894286
2361+g, tdbSNP:377252087
2382+a, tdbSNP:199474687
2434+a, gdbSNP:370390229
2435+a, tdbSNP:377690758
2437+c, tdbSNP:142419805
2442+a, gdbSNP:374387337
2444+g, tdbSNP:104894282
2450+c, tdbSNP:121918572
2457+a, gdbSNP:121918569
2469+a, tdbSNP:200300629
2528+a, gdbSNP:151322536
2552+a, gdbSNP:61752933
2575+a, gdbSNP:61758791
2583+a, gdbSNP:2227973
2592+a, cdbSNP:147656090
2645+c, tdbSNP:104894287
2651+a, gdbSNP:186717025
2676+a, gdbSNP:142345523
2688+a, tdbSNP:199474690
2693+g, tdbSNP:376140107
2695+c, tdbSNP:141560248
2727+c, tdbSNP:193922462
2729+a, gdbSNP:201313833
2749+c, gdbSNP:200264827
2750+a, gdbSNP:145772007
2762+a, gdbSNP:4151033
2778+g, tdbSNP:199474691
2783+a, gdbSNP:4151034
2839+c, tdbSNP:138119069
2859+a, gdbSNP:104894290
2875+a, gdbSNP:150721661
2877+a, gdbSNP:368073575
2898+c, tdbSNP:144893101
2916+a, cdbSNP:75591129
2932+a, cdbSNP:199921936
2938+g, tdbSNP:104894283
2968+a, tdbSNP:377118671
2991+c, tdbSNP:182385524
2994+g, tdbSNP:375775893
2998+a, gdbSNP:138510915
3004+a, gdbSNP:1980131
3028+a, cdbSNP:193922463
3047+c, tdbSNP:121918570
3048+a, gdbSNP:150739647
3066+a, cdbSNP:104894288
3079+c, tdbSNP:139084848
3115+c, tdbSNP:368169159
3127+c, tdbSNP:372337671
3140+a, gdbSNP:139113046
3149+c, tdbSNP:376829075
3150+a, gdbSNP:200043512
3213+g, tdbSNP:369891733
3241+g, tdbSNP:377660600
3263+c, tdbSNP:369833659
3279+a, gdbSNP:189589191
3494+a, gdbSNP:4151035
3529+g, tdbSNP:144069419
3593..3594+, accc, cacdbSNP:141129968
3654+a, gdbSNP:4151036
3676+c, tdbSNP:4151037
3696+a, gdbSNP:115582302
3840..3841+, cdbSNP:35276810
3845+a, gdbSNP:4151038
3995+c, tdbSNP:4151039
4339+c, tdbSNP:4151040
4356+c, tdbSNP:112766186
4357+a, gdbSNP:145963034
4360+a, gdbSNP:4151041
complement(4422)-c, adbSNP:139938937
4434+a, gdbSNP:149724031
4531+a, gdbSNP:113060327
4535+g, tdbSNP:372716805
4622+a, gdbSNP:371127461
4706+a, gdbSNP:187884172
4750+a, cdbSNP:4151042
4818+a, gdbSNP:185464049
4839+c, tdbSNP:374618480
complement(5017)-g, adbSNP:145552187
5189+c, gdbSNP:4151043
5234+c, tdbSNP:4151044
5266+a, tdbSNP:188175007
5321+, tdbSNP:35353578
complement(5421)-t, cdbSNP:148483119
5454+a, gdbSNP:367588231
5500+c, tdbSNP:371468874
5502+c, tdbSNP:4151045
5545+c, tdbSNP:200013770
5585+g, tdbSNP:4151046
5606+a, gdbSNP:367970747
5786+g, tdbSNP:4151047
5797+a, gdbSNP:192931118
5855+a, cdbSNP:375155856
5910+a, gdbSNP:369536926
5954..5955+, tdbSNP:4151048
5954..5955+, tdbSNP:386591599
5956+c, tdbSNP:375925922
6070+c, tdbSNP:184027330
6073+c, tdbSNP:188367509
6080+a, cdbSNP:371670021
6192..6195+, taagdbSNP:199555129
6276+g, tdbSNP:180966342
6286..6287+, tadbSNP:143299264
6313+a, cdbSNP:370179558
6367+, tdbSNP:141384582
6412+a, gdbSNP:183729240
complement(6440)-t, cdbSNP:1056403
6472+a, gdbSNP:190801060
6528+g, tdbSNP:368074902
6563+, adbSNP:4151049
Gene SymbolRAG1
Gene SynonymRAG-1; RNF74
Chromosome11
Locus Map11p13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000448 Homo sapiens recombination activating gene 1 (RAG1), mRNA. In-stock $1149.00 16
NM_000448 Homo sapiens recombination activating gene 1 (RAG1), mRNA. In-stock $1149.00 16
Title Novel RAG1 mutation in a case of severe combined immunodeficiency .
Author Zhang J, Quintal L, Atkinson A, Williams B, Grunebaum E and Roifman CM.
Journal Pediatrics 116 (3), E445-E449 (2005)
Title The immunophenotypic and immunogenotypic B-cell differentiation arrest in bone marrow of RAG-deficient SCID patients corresponds to residual recombination activities of mutated RAG proteins .
Author Noordzij JG, de Bruin-Versteeg S, Verkaik NS, Vossen JM, de Groot R, Bernatowska E, Langerak AW, van Gent DC and van Dongen JJ.
Journal Blood 100 (6), 2145-2152 (2002)
Title Identical mutations in RAG1 or RAG2 genes leading to defective V(D)J recombinase activity can cause either T-B-severe combined immune deficiency or Omenn syndrome .
Author Corneo B, Moshous D, Gungor T, Wulffraat N, Philippet P, Le Deist FL, Fischer A and de Villartay JP.
Journal Blood 97 (9), 2772-2776 (2001)
Title V(D)J recombination defects in lymphocytes due to RAG mutations: severe immunodeficiency with a spectrum of clinical presentations .
Author Villa A, Sobacchi C, Notarangelo LD, Bozzi F, Abinun M, Abrahamsen TG, Arkwright PD, Baniyash M, Brooks EG, Conley ME, Cortes P, Duse M, Fasth A, Filipovich AM, Infante AJ, Jones A, Mazzolari E, Muller SM, Pasic S, Rechavi G, Sacco MG, Santagata S, Schroeder ML, Seger R, Strina D, Ugazio A, Valiaho J, Vihinen M, Vogler LB, Ochs H, Vezzoni P, Friedrich W and Schwarz K.
Journal Blood 97 (1), 81-88 (2001)
Title N-terminal RAG1 frameshift mutations in Omenn's syndrome: internal methionine usage leads to partial V(D)J recombination activity and reveals a fundamental role in vivo for the N-terminal domains .
Author Santagata S, Gomez CA, Sobacchi C, Bozzi F, Abinun M, Pasic S, Cortes P, Vezzoni P and Villa A.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (26), 14572-14577 (2000)
Title Characterization of immune function and analysis of RAG gene mutations in Omenn syndrome and related disorders .
Author Wada T, Takei K, Kudo M, Shimura S, Kasahara Y, Koizumi S, Kawa-Ha K, Ishida Y, Imashuku S, Seki H and Yachie A.
Journal Clin. Exp. Immunol. 119 (1), 148-155 (2000)
Title Functional role of interleukin-4 (IL-4) and IL-7 in the development of X-linked severe combined immunodeficiency .
Author Kumaki S, Ishii N, Minegishi M, Tsuchiya S, Cosman D, Sugamura K and Konno T.
Journal Blood 93 (2), 607-612 (1999)
Title Partial V(D)J recombination activity leads to Omenn syndrome .
Author Villa A, Santagata S, Bozzi F, Giliani S, Frattini A, Imberti L, Gatta LB, Ochs HD, Schwarz K, Notarangelo LD, Vezzoni P and Spanopoulou E.
Journal Cell 93 (5), 885-896 (1998)
Title In vitro cell death of activated lymphocytes in Omenn's syndrome .
Author Brugnoni D, Airo P, Facchetti F, Blanzuoli L, Ugazio AG, Cattaneo R and Notarangelo LD.
Journal Eur. J. Immunol. 27 (11), 2765-2773 (1997)
Title RAG mutations in human B cell-negative SCID .
Author Schwarz K, Gauss GH, Ludwig L, Pannicke U, Li Z, Lindner D, Friedrich W, Seger RA, Hansen-Hagge TE, Desiderio S, Lieber MR and Bartram CR.
Journal Science 274 (5284), 97-99 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.