• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens serine/threonine kinase 11 (STK11), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25446 Homo sapiens serine/threonine kinase 11 (STK11), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu25446C Homo sapiens serine/threonine kinase 11 (STK11), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000455.4, 58530881
Length 1302 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens serine/threonine kinase 11 (STK11), mRNA.
Product serine/threonine-protein kinase STK11
Comment

Summary: This gene, which encodes a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in this gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq, Jul 2008].

RefSeq NP_000446.1
CDS 1116..2417
Misc Feature(1)933..935
Misc Feature(2)1206..1208
Misc Feature(3)1206..1208
Misc Feature(4)1260..2042
Misc Feature(5)1278..2033
Misc Feature(6)order(1278..1292,1302..1304,1341..1343,1347..1349,
Misc Feature(7)order(1278..1292,1302..1304,1341..1343,1347..1349,
Misc Feature(8)order(1290..1292,1524..1526,1641..1643,1647..1649,
Misc Feature(9)1680..1682
Misc Feature(10)1680..1682
Misc Feature(11)order(1692..1712,1758..1769)
Misc Feature(12)2088..2090
Misc Feature(13)2121..2123
Misc Feature(14)2121..2123
Misc Feature(15)2202..2204
Misc Feature(16)2202..2204
Misc Feature(17)2397..2399
Misc Feature(18)2397..2399
Misc Feature(19)2397..2399
Misc Feature(20)2397..2399
Misc Feature(21)2397..2399
Misc Feature(22)2403..2405
Exon (1)1..1405
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (2)1406..1489
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (3)1490..1579
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (4)1580..1712
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (5)1713..1849
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (6)1850..1977
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (7)1978..2035
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (8)2036..2223
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (9)2224..2433
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (10)2434..3276
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Translation MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPG NLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS AGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI RQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDI IYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA SSKIRRLSACKQQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
92+dbSNP:
92+c, tdbSNP:147615524
500+c, tdbSNP:374662865
554+c, gdbSNP:187649480
644+g, tdbSNP:377710130
665+c, gdbSNP:370310671
686+c, tdbSNP:115594813
799+c, gdbSNP:139547716
805+c, tdbSNP:149756065
837+a, gdbSNP:145618004
842+c, tdbSNP:372994361
1211+c, gdbSNP:79175212
1223+a, cdbSNP:137853079
1224+c, tdbSNP:121913324
1240+a, gdbSNP:148830698
1241+a, gdbSNP:376401094
1260+g, tdbSNP:137853080
1284..1285+, gdbSNP:398123404
1284+, gdbSNP:121913319
1284+g, tdbSNP:137854584
1296+a, gdbSNP:368993118
1312..1313+, tdbSNP:397518441
1315+c, tdbSNP:137853077
1363+a, gdbSNP:374006397
1365+a, tdbSNP:137853076
1379+a, cdbSNP:56354945
1421+dbSNP:
1421+c, gdbSNP:370130178
1432+a, gdbSNP:375622587
1445+c, tdbSNP:368548358
1472+c, tdbSNP:372511774
1481+a, gdbSNP:376969448
1484+a, gdbSNP:140112347
1518+dbSNP:
1518+c, gdbSNP:137853081
1533+, cdbSNP:397518440
1547+a, gdbSNP:376788924
1549+a, gdbSNP:369764220
1603+dbSNP:
1603+a, gdbSNP:137853078
1610+a, gdbSNP:370446299
1623+c, tdbSNP:121913323
1695+a, g, tdbSNP:121913315
1696+a, tdbSNP:121913316
1710+a, g, tdbSNP:121913317
1733+dbSNP:
1733+a, gdbSNP:370976710
1746+c, tdbSNP:185087320
1763+c, tdbSNP:376083300
1765+, cdbSNP:397518442
1766+a, gdbSNP:368348370
1832+c, gdbSNP:137853082
1853+dbSNP:
1853+c, gdbSNP:137853083
1874+a, cdbSNP:137853075
1902..1905+, ttgtdbSNP:121913320
1902+c, tdbSNP:372378119
1931+c, tdbSNP:9282859
1940+a, gdbSNP:202011521
1943+c, tdbSNP:200824447
1952+c, tdbSNP:373021819
1956+a, cdbSNP:377208033
1957+, cdbSNP:121913321
1957+c, tdbSNP:121913322
1991+dbSNP:
1991+c, tdbSNP:148928808
1992+g, tdbSNP:398123405
2009+a, cdbSNP:199681533
2017+a, gdbSNP:370222210
2026+a, gdbSNP:376280361
2051+dbSNP:
2051+, adbSNP:397518443
2060+a, gdbSNP:376329042
2086+c, tdbSNP:367807476
2107+a, gdbSNP:371264852
2111+a, gdbSNP:121913325
2129+a, gdbSNP:375462277
2142+a, gdbSNP:368547224
2147+a, gdbSNP:371928158
2151+a, gdbSNP:375431906
2154+a, gdbSNP:369744528
2177+c, gdbSNP:59912467
2183+a, cdbSNP:187744790
2222+c, tdbSNP:376069854
2242+dbSNP:
2242+a, cdbSNP:373888280
2245+c, tdbSNP:199973552
2266+a, gdbSNP:371102112
2283+a, gdbSNP:374078532
2285+a, gdbSNP:367911165
2297+c, tdbSNP:376679847
2300+a, gdbSNP:370207155
2309+a, gdbSNP:184271025
2315+a, gdbSNP:368661707
2326+c, tdbSNP:200078204
2328+a, tdbSNP:376718324
2340+c, tdbSNP:368466538
2344+c, tdbSNP:372329880
2372+c, tdbSNP:375328708
2374+c, tdbSNP:369033659
2393+a, gdbSNP:201256614
2399+a, c, gdbSNP:369097329
2506+dbSNP:
2506+a, gdbSNP:181155548
complement(2580)-g, cdbSNP:11552326
2601+a, gdbSNP:185409489
2659+a, cdbSNP:113161978
2731+a, gdbSNP:190680390
2873..2875+, gttdbSNP:369942515
3023+c, tdbSNP:370265572
3033+c, tdbSNP:10415095
3046+c, tdbSNP:368014506
3102+a, cdbSNP:111773256
3124+a, gdbSNP:181506760
3255..3263+, aagcttgggdbSNP:142990629
Gene SymbolSTK11
Gene SynonymhLKB1; LKB1; PJS
Chromosome19
Locus Map19p13.3
Title Loss of LKB1 and PTEN tumor suppressor genes in the ovarian surface epithelium induces papillary serous ovarian cancer .
Author Tanwar PS, Mohapatra G, Chiang S, Engler DA, Zhang L, Kaneko-Tarui T, Ohguchi Y, Birrer MJ and Teixeira JM.
Journal Carcinogenesis 35 (3), 546-553 (2014)
Title Loss of the tumor suppressor LKB1 promotes metabolic reprogramming of cancer cells via HIF-1alpha .
Author Faubert B, Vincent EE, Griss T, Samborska B, Izreig S, Svensson RU, Mamer OA, Avizonis D, Shackelford DB, Shaw RJ and Jones RG.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (7), 2554-2559 (2014)
Title Liver kinase B1 expression promotes phosphatase activity and abrogation of receptor tyrosine kinase phosphorylation in human cancer cells .
Author Okon IS, Coughlan KA and Zou MH.
Journal J. Biol. Chem. 289 (3), 1639-1648 (2014)
Title A genetic screen identifies an LKB1-MARK signalling axis controlling the Hippo-YAP pathway .
Author Mohseni M, Sun J, Lau A, Curtis S, Goldsmith J, Fox VL, Wei C, Frazier M, Samson O, Wong KK, Kim C and Camargo FD.
Journal Nat. Cell Biol. 16 (1), 108-117 (2014)
Title Exome sequencing revealed novel germline mutations in Chinese Peutz-Jeghers syndrome patients .
Author Wang HH, Xie NN, Li QY, Hu YQ, Ren JL and Guleng B.
Journal Dig. Dis. Sci. 59 (1), 64-71 (2014)
Title Low frequency of somatic mutations in the LKB1/Peutz-Jeghers syndrome gene in sporadic breast cancer .
Author Bignell GR, Barfoot R, Seal S, Collins N, Warren W and Stratton MR.
Journal Cancer Res. 58 (7), 1384-1386 (1998)
Title A serine/threonine kinase gene defective in Peutz-Jeghers syndrome .
Author Hemminki A, Markie D, Tomlinson I, Avizienyte E, Roth S, Loukola A, Bignell G, Warren W, Aminoff M, Hoglund P, Jarvinen H, Kristo P, Pelin K, Ridanpaa M, Salovaara R, Toro T, Bodmer W, Olschwang S, Olsen AS, Stratton MR, de la Chapelle A and Aaltonen LA.
Journal Nature 391 (6663), 184-187 (1998)
Title Peutz-Jeghers syndrome is caused by mutations in a novel serine threonine kinase .
Author Jenne DE, Reimann H, Nezu J, Friedel W, Loff S, Jeschke R, Muller O, Back W and Zimmer M.
Journal Nat. Genet. 18 (1), 38-43 (1998)
Title Localization of a susceptibility locus for Peutz-Jeghers syndrome to 19p using comparative genomic hybridization and targeted linkage analysis .
Author Hemminki A, Tomlinson I, Markie D, Jarvinen H, Sistonen P, Bjorkqvist AM, Knuutila S, Salovaara R, Bodmer W, Shibata D, de la Chapelle A and Aaltonen LA.
Journal Nat. Genet. 15 (1), 87-90 (1997)
Title Peutz-Jeghers Syndrome .
Author McGarrity,T.J., Amos,C.I., Frazier,M.L. and Wei,C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.