• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens serine/threonine kinase 11 (STK11), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000455 Homo sapiens serine/threonine kinase 11 (STK11), mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_000455.4, 58530881
Length 3286 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens serine/threonine kinase 11 (STK11), mRNA.
Product serine/threonine-protein kinase STK11
Comment

Summary: This gene, which encodes a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in this gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq, Jul 2008].

RefSeq NP_000446.1
CDS 1116..2417
Misc Feature(1)933..935
Misc Feature(2)1206..1208
Misc Feature(3)1206..1208
Misc Feature(4)1260..2042
Misc Feature(5)1278..2033
Misc Feature(6)order(1278..1292,1302..1304,1341..1343,1347..1349,
Misc Feature(7)order(1278..1292,1302..1304,1341..1343,1347..1349,
Misc Feature(8)order(1290..1292,1524..1526,1641..1643,1647..1649,
Misc Feature(9)1680..1682
Misc Feature(10)1680..1682
Misc Feature(11)order(1692..1712,1758..1769)
Misc Feature(12)2088..2090
Misc Feature(13)2121..2123
Misc Feature(14)2121..2123
Misc Feature(15)2202..2204
Misc Feature(16)2202..2204
Misc Feature(17)2397..2399
Misc Feature(18)2397..2399
Misc Feature(19)2397..2399
Misc Feature(20)2397..2399
Misc Feature(21)2397..2399
Misc Feature(22)2403..2405
Exon (1)1..1405
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (2)1406..1489
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (3)1490..1579
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (4)1580..1712
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (5)1713..1849
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (6)1850..1977
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (7)1978..2035
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (8)2036..2223
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (9)2224..2433
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Exon (10)2434..3276
Gene:STK11
Gene Synonym:hLKB1; LKB1; PJS
Translation MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPG NLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS AGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI RQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDI IYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA SSKIRRLSACKQQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
92+dbSNP:
92+c, tdbSNP:147615524
554+c, gdbSNP:187649480
686+c, tdbSNP:115594813
799+c, gdbSNP:139547716
805+c, tdbSNP:149756065
837+a, gdbSNP:145618004
1099+, adbSNP:66915176
1209+, adbSNP:66832117
1211+c, gdbSNP:79175212
1223+a, cdbSNP:137853079
1224+c, tdbSNP:121913324
1240+a, gdbSNP:148830698
1257+, adbSNP:68117541
1260+g, tdbSNP:137853080
1284+, gdbSNP:121913319
1284+g, tdbSNP:137854584
1315+c, tdbSNP:137853077
1365+a, tdbSNP:137853076
1379+a, cdbSNP:56354945
1484+dbSNP:
1484+a, gdbSNP:140112347
1518+dbSNP:
1518+c, gdbSNP:137853081
1603+dbSNP:
1603+a, gdbSNP:137853078
1623+c, tdbSNP:121913323
1695+a, g, tdbSNP:121913315
1696+a, tdbSNP:121913316
1710+a, g, tdbSNP:121913317
1746+dbSNP:
1746+c, tdbSNP:185087320
1832+c, gdbSNP:137853082
1853+dbSNP:
1853+c, gdbSNP:137853083
1874+a, cdbSNP:137853075
1902..1905+, ttgtdbSNP:121913320
1931+c, tdbSNP:9282859
1940+a, gdbSNP:202011521
1943+c, tdbSNP:200824447
1952..1953+, cdbSNP:67873004
1957+, cdbSNP:121913321
1957+c, tdbSNP:121913322
1991+dbSNP:
1991+c, tdbSNP:148928808
2009+a, cdbSNP:199681533
2111+dbSNP:
2111+a, gdbSNP:121913325
2177+c, gdbSNP:59912467
2183+a, cdbSNP:187744790
2245+dbSNP:
2245+c, tdbSNP:199973552
2309+a, gdbSNP:184271025
2326+c, tdbSNP:200078204
2393+a, gdbSNP:201256614
2506+dbSNP:
2506+a, gdbSNP:181155548
2580+c, gdbSNP:11552326
2601+a, gdbSNP:185409489
2659+a, cdbSNP:113161978
2731+a, gdbSNP:190680390
3033+c, tdbSNP:10415095
3102+a, cdbSNP:111773256
3124+a, gdbSNP:181506760
3255..3263+, aagcttgggdbSNP:142990629
3263+, gaagcttggdbSNP:75046712
Gene SymbolSTK11
Gene SynonymhLKB1; LKB1; PJS
Chromosome19
Locus Map19p13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000455 Homo sapiens serine/threonine kinase 11 (STK11), mRNA. In-stock $509.00 $460.00 12
Title Underexpression of tumour suppressor LKB1 in clear cell renal cell carcinoma is common and confers growth advantage in vitro and in vivo .
Author Duivenvoorden,W.C., Beatty,L.K., Lhotak,S., Hill,B., Mak,I., Paulin,G., Gallino,D., Popovic,S., Austin,R.C. and Pinthus,J.H.
Journal Br. J. Cancer 108 (2), 327-333 (2013)
Title The CRTC1-NEDD9 signaling axis mediates lung cancer progression caused by LKB1 loss .
Author Feng,Y., Wang,Y., Wang,Z., Fang,Z., Li,F., Gao,Y., Liu,H., Xiao,T., Li,F., Zhou,Y., Zhai,Q., Liu,X., Sun,Y., Bardeesy,N., Wong,K.K., Chen,H., Xiong,Z.Q. and Ji,H.
Journal Cancer Res. 72 (24), 6502-6511 (2012)
Title Post-translational modification of serine/threonine kinase LKB1 via Adduction of the Reactive Lipid Species 4-Hydroxy-trans-2-nonenal (HNE) at lysine residue 97 directly inhibits kinase activity .
Author Calamaras,T.D., Lee,C., Lan,F., Ido,Y., Siwik,D.A. and Colucci,W.S.
Journal J. Biol. Chem. 287 (50), 42400-42406 (2012)
Title The nuclear protein Artemis promotes AMPK activation by stabilizing the LKB1-AMPK complex .
Author Nakagawa,K., Uehata,Y., Natsuizaka,M., Kohara,T., Darmanin,S., Asaka,M., Takeda,H. and Kobayashi,M.
Journal Biochem. Biophys. Res. Commun. 427 (4), 790-795 (2012)
Title Negative regulation of AMP-activated protein kinase (AMPK) activity by macrophage migration inhibitory factor (MIF) family members in non-small cell lung carcinomas .
Author Brock,S.E., Rendon,B.E., Yaddanapudi,K. and Mitchell,R.A.
Journal J. Biol. Chem. 287 (45), 37917-37925 (2012)
Title Nine novel germline mutations of STK11 in ten families with Peutz-Jeghers syndrome .
Author Nakagawa,H., Koyama,K., Miyoshi,Y., Ando,H., Baba,S., Watatani,M., Yasutomi,M., Matsuura,N., Monden,M. and Nakamura,Y.
Journal Hum. Genet. 103 (2), 168-172 (1998)
Title Low frequency of somatic mutations in the LKB1/Peutz-Jeghers syndrome gene in sporadic breast cancer .
Author Bignell,G.R., Barfoot,R., Seal,S., Collins,N., Warren,W. and Stratton,M.R.
Journal Cancer Res. 58 (7), 1384-1386 (1998)
Title A serine/threonine kinase gene defective in Peutz-Jeghers syndrome .
Author Hemminki,A., Markie,D., Tomlinson,I., Avizienyte,E., Roth,S., Loukola,A., Bignell,G., Warren,W., Aminoff,M., Hoglund,P., Jarvinen,H., Kristo,P., Pelin,K., Ridanpaa,M., Salovaara,R., Toro,T., Bodmer,W., Olschwang,S., Olsen,A.S., Stratton,M.R., de la Chapelle,A. and Aaltonen,L.A.
Journal Nature 391 (6663), 184-187 (1998)
Title Peutz-Jeghers syndrome is caused by mutations in a novel serine threonine kinase .
Author Jenne,D.E., Reimann,H., Nezu,J., Friedel,W., Loff,S., Jeschke,R., Muller,O., Back,W. and Zimmer,M.
Journal Nat. Genet. 18 (1), 38-43 (1998)
Title Localization of a susceptibility locus for Peutz-Jeghers syndrome to 19p using comparative genomic hybridization and targeted linkage analysis .
Author Hemminki,A., Tomlinson,I., Markie,D., Jarvinen,H., Sistonen,P., Bjorkqvist,A.M., Knuutila,S., Salovaara,R., Bodmer,W., Shibata,D., de la Chapelle,A. and Aaltonen,L.A.
Journal Nat. Genet. 15 (1), 87-90 (1997)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.