• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens thrombopoietin (THPO), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000460 Homo sapiens thrombopoietin (THPO), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_000460.2, 40805871
Length 1805 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens thrombopoietin (THPO), transcript variant 1, mRNA.
Product thrombopoietin isoform 1 precursor
Comment

Summary: Megakaryocytopoiesis is the cellular development process that leads to platelet production. The protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternate splicing results in multiple transcript variants of this gene.[provided by RefSeq, Jun 2012].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).

RefSeq NP_000451.1
CDS 216..1277
Misc Feature(1)4
Misc Feature(2)4
Misc Feature(3)285..779
Misc Feature(4)order(297..299,729..731)
Misc Feature(5)order(363..365,531..533)
Misc Feature(6)387..389
Misc Feature(7)606..608
Misc Feature(8)750..752
Misc Feature(9)753..755
Misc Feature(10)765..767
Misc Feature(11)804..806
Misc Feature(12)831..833
Misc Feature(13)852..854
Misc Feature(14)915..917
Misc Feature(15)978..980
Misc Feature(16)1008..1010
Misc Feature(17)1233..1235
Misc Feature(18)1257..1259
Exon (1)1..70
Gene:THPO
Gene Synonym:MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Exon (2)71..228
Gene:THPO
Gene Synonym:MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Exon (3)229..356
Gene:THPO
Gene Synonym:MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Exon (4)357..443
Gene:THPO
Gene Synonym:MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Exon (5)444..611
Gene:THPO
Gene Synonym:MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Exon (6)612..1805
Gene:THPO
Gene Synonym:MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Translation MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPV LLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRL LLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTT AVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSL DQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP TGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(80)-dbSNP:
complement(80)-g, adbSNP:956732
complement(160)-t, cdbSNP:187556243
complement(209)-t, cdbSNP:140178375
complement(256)-dbSNP:
complement(256)-t, cdbSNP:1042346
complement(338)-g, adbSNP:199727920
complement(339)-t, cdbSNP:138940774
complement(352)-g, adbSNP:1126664
complement(386)-dbSNP:
complement(386)-c, adbSNP:145098681
complement(398)-c, adbSNP:200666378
complement(418)-t, cdbSNP:141465516
complement(513)-dbSNP:
complement(513)-t, cdbSNP:201796235
complement(525)-t, gdbSNP:200191903
complement(562)-t, g, adbSNP:1126665
complement(571)-t, cdbSNP:143216798
complement(590)-t, cdbSNP:201261692
complement(644..645)-dbSNP:
complement(644..645)-, cdbSNP:34037653
complement(697)-t, cdbSNP:149021319
complement(738)-t, gdbSNP:144953270
complement(754)-t, gdbSNP:201680404
complement(765)-t, cdbSNP:149896952
complement(794)-g, adbSNP:202166253
complement(854)-t, adbSNP:1042348
complement(905)-g, adbSNP:147413234
complement(919)-t, cdbSNP:144399926
complement(968)-g, c, adbSNP:140658452
complement(988)-t, cdbSNP:147206404
complement(1011)-g, adbSNP:186070598
complement(1019)-t, gdbSNP:201887623
complement(1067)-t, cdbSNP:150122652
complement(1078)-g, adbSNP:141844395
complement(1129)-g, adbSNP:148499454
complement(1157)-g, adbSNP:199637036
complement(1158)-t, gdbSNP:200414155
complement(1172)-g, cdbSNP:144745352
complement(1188)-g, adbSNP:62287511
complement(1195)-g, adbSNP:60207161
complement(1202)-g, adbSNP:201163272
complement(1208)-t, cdbSNP:149384875
complement(1244)-g, adbSNP:201109797
complement(1245)-g, adbSNP:35794435
complement(1295)-t, cdbSNP:180680111
complement(1304)-t, cdbSNP:201864435
complement(1312)-g, adbSNP:6141
complement(1336)-t, cdbSNP:78565404
complement(1406)-t, cdbSNP:56305905
complement(1667)-t, gdbSNP:188318763
complement(1759)-t, adbSNP:3804618
Gene SymbolTHPO
Gene SynonymMGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Chromosome3
Locus Map3q27
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000460 Homo sapiens thrombopoietin (THPO), transcript variant 1, mRNA. In-stock $418.00 $369.00 10
NM_001177597 Homo sapiens thrombopoietin (THPO), transcript variant 2, mRNA. In-stock $418.00 $369.00 10
NM_001177598 Homo sapiens thrombopoietin (THPO), transcript variant 3, mRNA. On-demand $549.00 14
Title Platelet count and serum thrombopoietin level as predictors for morbidity and/or mortality in thrombocytopenic neonates .
Author Al-Tonbary,Y., Al-Haggar,M., Salama,O., Abul-Kheir,M., El-Alfy,A. and Hafez,M.
Journal Hematology 17 (6), 341-345 (2012)
Title Involvement of thrombopoietin in acinar cell necrosis in L-arginine-induced acute pancreatitis in mice .
Author Shen,J., Wan,R., Hu,G., Wang,F., Shen,J. and Wang,X.
Journal Cytokine 60 (1), 294-301 (2012)
Title Mutation in the THPO gene is not associated with aplastic anaemia in Japanese children .
Author Wang,X., Muramatsu,H., Sakaguchi,H., Xu,Y., Narita,A., Tsumura,Y., Doisaki,S., Tanaka,M., Ismael,O., Shimada,A., Hama,A., Takahashi,Y. and Kojima,S.
Journal Br. J. Haematol. 158 (4), 553-555 (2012)
Title Thrombopoietin as biomarker and mediator of cardiovascular damage in critical diseases .
Author Lupia,E., Goffi,A., Bosco,O. and Montrucchio,G.
Journal Mediators Inflamm. 2012, 390892 (2012)
Title Genomic structure, chromosomal localization, and conserved alternative splice forms of thrombopoietin .
Author Gurney,A.L., Kuang,W.J., Xie,M.H., Malloy,B.E., Eaton,D.L. and de Sauvage,F.J.
Journal Blood 85 (4), 981-988 (1995)
Title Cloning and characterization of the human megakaryocyte growth and development factor (MGDF) gene .
Author Chang,M.S., McNinch,J., Basu,R., Shutter,J., Hsu,R.Y., Perkins,C., Mar,V., Suggs,S., Welcher,A., Li,L. et al.
Journal J. Biol. Chem. 270 (2), 511-514 (1995)
Title Human thrombopoietin: gene structure, cDNA sequence, expression, and chromosomal localization .
Author Foster,D.C., Sprecher,C.A., Grant,F.J., Kramer,J.M., Kuijper,J.L., Holly,R.D., Whitmore,T.E., Heipel,M.D., Bell,L.A., Ching,A.F. et al.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (26), 13023-13027 (1994)
Title Molecular cloning and chromosomal localization of the human thrombopoietin gene .
Author Sohma,Y., Akahori,H., Seki,N., Hori,T., Ogami,K., Kato,T., Shimada,Y., Kawamura,K. and Miyazaki,H.
Journal FEBS Lett. 353 (1), 57-61 (1994)
Title Identification and cloning of a megakaryocyte growth and development factor that is a ligand for the cytokine receptor Mpl .
Author Bartley,T.D., Bogenberger,J., Hunt,P., Li,Y.S., Lu,H.S., Martin,F., Chang,M.S., Samal,B., Nichol,J.L., Swift,S. et al.
Journal Cell 77 (7), 1117-1124 (1994)
Title Stimulation of megakaryocytopoiesis and thrombopoiesis by the c-Mpl ligand .
Author de Sauvage,F.J., Hass,P.E., Spencer,S.D., Malloy,B.E., Gurney,A.L., Spencer,S.A., Darbonne,W.C., Henzel,W.J., Wong,S.C., Kuang,W.J. et al.
Journal Nature 369 (6481), 533-538 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.