• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens thrombopoietin (THPO), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000460 Homo sapiens thrombopoietin (THPO), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_000460.3, 586798198
Length 1923 bp
Structure linear
Update Date 16-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens thrombopoietin (THPO), transcript variant 1, mRNA.
Product thrombopoietin isoform 1 precursor
Comment

Summary: Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent. [provided by RefSeq, Feb 2014].


Transcript Variant: This variant (1) represents use of the downstream promoter and comprises six exons. It encodes the main functional protein (isoform 1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000451.1
CDS 280..1341
Misc Feature(1)1
Misc Feature(2)1
Misc Feature(3)21
Misc Feature(4)23..139
Misc Feature(5)28
Misc Feature(6)31
Misc Feature(7)44
Misc Feature(8)45
Misc Feature(9)62..139
Misc Feature(10)71
Misc Feature(11)210..293
Misc Feature(12)349..843
Misc Feature(13)order(361..363,793..795)
Misc Feature(14)order(427..429,595..597)
Misc Feature(15)451..453
Misc Feature(16)670..672
Misc Feature(17)814..816
Misc Feature(18)817..819
Misc Feature(19)829..831
Misc Feature(20)868..870
Misc Feature(21)895..897
Misc Feature(22)916..918
Misc Feature(23)979..981
Misc Feature(24)1042..1044
Misc Feature(25)1072..1074
Misc Feature(26)1297..1299
Misc Feature(27)1321..1323
Exon (1)1..134
Gene:THPO
Gene Synonym:MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Exon (2)135..292
Gene:THPO
Gene Synonym:MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Exon (3)293..420
Gene:THPO
Gene Synonym:MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Exon (4)421..507
Gene:THPO
Gene Synonym:MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Exon (5)508..675
Gene:THPO
Gene Synonym:MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Exon (6)676..1919
Gene:THPO
Gene Synonym:MGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Translation MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPV LLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRL LLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTT AVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSL DQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP TGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(21)-t, cdbSNP:41266279
complement(144)-dbSNP:
complement(144)-g, adbSNP:956732
complement(203)-g, adbSNP:368010978
complement(224)-t, cdbSNP:187556243
complement(246)-g, cdbSNP:376159996
complement(269)-t, gdbSNP:373675707
complement(273)-t, cdbSNP:140178375
complement(303)-dbSNP:
complement(303)-g, adbSNP:373542698
complement(304)-t, cdbSNP:368772724
complement(320)-t, cdbSNP:386512888
320+c, tdbSNP:1042346
complement(392)-t, cdbSNP:377412493
complement(402)-g, adbSNP:199727920
complement(403)-t, cdbSNP:138940774
416+a, gdbSNP:1126664
complement(462)-dbSNP:
complement(462)-c, adbSNP:200666378
complement(482)-t, cdbSNP:141465516
complement(560)-dbSNP:
complement(560)-t, cdbSNP:376708508
complement(575)-t, cdbSNP:372259684
complement(577)-t, cdbSNP:201796235
complement(589)-t, gdbSNP:200191903
complement(615)-t, cdbSNP:367562708
626+a, g, tdbSNP:1126665
complement(635)-t, cdbSNP:143216798
complement(639)-g, adbSNP:375553609
complement(654)-t, cdbSNP:201261692
complement(656)-t, adbSNP:373801614
complement(707..708)-dbSNP:
complement(707..708)-, cdbSNP:34037653
complement(747)-g, cdbSNP:374073031
complement(761)-t, cdbSNP:149021319
complement(774)-g, adbSNP:371183267
complement(778)-g, cdbSNP:376829833
complement(795)-g, adbSNP:375403097
complement(810)-t, cdbSNP:371267401
complement(818)-t, gdbSNP:201680404
complement(829)-t, cdbSNP:149896952
complement(858)-g, adbSNP:202166253
918+a, tdbSNP:1042348
complement(956)-t, cdbSNP:377352648
complement(983)-t, cdbSNP:144399926
complement(1032)-g, c, adbSNP:140658452
complement(1052)-t, cdbSNP:147206404
complement(1075)-g, adbSNP:186070598
complement(1076)-t, cdbSNP:373300042
complement(1083)-t, gdbSNP:201887623
complement(1092)-g, adbSNP:368937790
complement(1131)-t, cdbSNP:150122652
complement(1193)-g, adbSNP:148499454
complement(1221)-g, adbSNP:199637036
complement(1222)-t, gdbSNP:200414155
complement(1236)-g, cdbSNP:144745352
complement(1242)-g, adbSNP:377138170
complement(1252)-g, adbSNP:62287511
complement(1259)-g, adbSNP:60207161
complement(1266)-g, adbSNP:201163272
complement(1271)-t, gdbSNP:372984771
complement(1272)-t, cdbSNP:149384875
complement(1305)-g, cdbSNP:369650492
complement(1308)-g, adbSNP:201109797
complement(1309)-g, adbSNP:35794435
complement(1343)-t, cdbSNP:377310955
complement(1350)-c, adbSNP:375561267
complement(1359)-t, cdbSNP:180680111
complement(1368)-t, cdbSNP:201864435
complement(1369)-g, adbSNP:375526030
1376+a, gdbSNP:6141
complement(1400)-t, cdbSNP:78565404
complement(1460)-g, adbSNP:375028991
complement(1470)-t, cdbSNP:56305905
complement(1731)-t, gdbSNP:188318763
1823+a, tdbSNP:3804618
complement(1891)-t, cdbSNP:374303064
Gene SymbolTHPO
Gene SynonymMGDF; MKCSF; ML; MPLLG; THCYT1; TPO
Chromosome3
Locus Map3q27
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001290027 Homo sapiens thrombopoietin (THPO), transcript variant 8, mRNA. On-demand $449.00 14
NM_001290026 Homo sapiens thrombopoietin (THPO), transcript variant 7, mRNA. On-demand $549.00 14
NM_001290022 Homo sapiens thrombopoietin (THPO), transcript variant 6, mRNA. On-demand $549.00 14
NM_001289997 Homo sapiens thrombopoietin (THPO), transcript variant 4, mRNA. On-demand $449.00 14
NM_001289998 Homo sapiens thrombopoietin (THPO), transcript variant 5, mRNA. On-demand $549.00 14
NM_001177598 Homo sapiens thrombopoietin (THPO), transcript variant 3, mRNA. On-demand $549.00 14
NM_001290003 Homo sapiens thrombopoietin (THPO), transcript variant 5, mRNA. On-demand $699.00 18
NM_001177597 Homo sapiens thrombopoietin (THPO), transcript variant 2, mRNA. In-stock $418.00 $369.00 10
NM_000460 Homo sapiens thrombopoietin (THPO), transcript variant 1, mRNA. In-stock $418.00 $369.00 10
NM_001290028 Homo sapiens thrombopoietin (THPO), transcript variant 9, mRNA. On-demand $549.00 14
XM_006713738 PREDICTED: Homo sapiens thrombopoietin (THPO), transcript variant X2, mRNA. On-demand $699.00 18
XM_006713739 PREDICTED: Homo sapiens thrombopoietin (THPO), transcript variant X3, mRNA. On-demand $699.00 18
XM_005247737 PREDICTED: Homo sapiens thrombopoietin (THPO), transcript variant X1, mRNA. On-demand $699.00 18
Title Exome sequencing reveals a thrombopoietin ligand mutation in a Micronesian family with autosomal recessive aplastic anemia .
Author Dasouki MJ, Rafi SK, Olm-Shipman AJ, Wilson NR, Abhyankar S, Ganter B, Furness LM, Fang J, Calado RT and Saadi I.
Journal Blood 122 (20), 3440-3449 (2013)
Title Functional and structural profiling of the human thrombopoietin gene promoter .
Author Dordelmann C, Telgmann R, Brand E, Hagedorn C, Schroer B, Hasenkamp S, Baumgart P, Kleine-Katthofer P, Paul M and Brand-Herrmann SM.
Journal J. Biol. Chem. 283 (36), 24382-24391 (2008)
Title Thrombopoietin production is inhibited by a translational mechanism .
Author Ghilardi N, Wiestner A and Skoda RC.
Journal Blood 92 (11), 4023-4030 (1998)
Title An activating splice donor mutation in the thrombopoietin gene causes hereditary thrombocythaemia .
Author Wiestner A, Schlemper RJ, van der Maas AP and Skoda RC.
Journal Nat. Genet. 18 (1), 49-52 (1998)
Title Characterization of the human thrombopoietin gene promoter. A possible role of an Ets transcription factor, E4TF1/GABP .
Author Kamura T, Handa H, Hamasaki N and Kitajima S.
Journal J. Biol. Chem. 272 (17), 11361-11368 (1997)
Title Genomic structure, chromosomal localization, and conserved alternative splice forms of thrombopoietin .
Author Gurney AL, Kuang WJ, Xie MH, Malloy BE, Eaton DL and de Sauvage FJ.
Journal Blood 85 (4), 981-988 (1995)
Title Cloning and characterization of the human megakaryocyte growth and development factor (MGDF) gene .
Author Chang MS, McNinch J, Basu R, Shutter J, Hsu RY, Perkins C, Mar V, Suggs S, Welcher A and Li L.
Journal J. Biol. Chem. 270 (2), 511-514 (1995)
Title Human thrombopoietin: gene structure, cDNA sequence, expression, and chromosomal localization .
Author Foster DC, Sprecher CA, Grant FJ, Kramer JM, Kuijper JL, Holly RD, Whitmore TE, Heipel MD, Bell LA and Ching AF.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (26), 13023-13027 (1994)
Title Molecular cloning and chromosomal localization of the human thrombopoietin gene .
Author Sohma Y, Akahori H, Seki N, Hori T, Ogami K, Kato T, Shimada Y, Kawamura K and Miyazaki H.
Journal FEBS Lett. 353 (1), 57-61 (1994)
Title Identification and cloning of a megakaryocyte growth and development factor that is a ligand for the cytokine receptor Mpl .
Author Bartley TD, Bogenberger J, Hunt P, Li YS, Lu HS, Martin F, Chang MS, Samal B, Nichol JL and Swift S.
Journal Cell 77 (7), 1117-1124 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.