• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens amyloid beta (A4) precursor protein (APP), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_000484 Homo sapiens amyloid beta (A4) precursor protein (APP), transcript variant 1, mRNA. ORF Sequence $670.77
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000484.3, 228008403
Length 3648 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens amyloid beta (A4) precursor protein (APP), transcript variant 1, mRNA.
Product amyloid beta A4 protein isoform a precursor
Comment

Summary: This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (a, also known as PreA4 770).

RefSeq NP_000475.1
CDS 201..2513
Misc Feature(1)24..26
Misc Feature(2)270..764
Misc Feature(3)288..593
Misc Feature(4)486..530
Misc Feature(5)594..764
Misc Feature(6)630..632
Misc Feature(7)741..764
Misc Feature(8)792..794
Misc Feature(9)816..818
Misc Feature(10)1071..1226
Misc Feature(11)order(1095..1109,1113..1115)
Misc Feature(12)1101..1106
Misc Feature(13)1293..1847
Misc Feature(14)1371..1469
Misc Feature(15)<1419..1622
Misc Feature(16)1671..1766
Misc Feature(17)1767..1820
Misc Feature(18)2202..2204
Misc Feature(19)2211..2216
Misc Feature(20)2214..>2315
Misc Feature(21)2214..2219
Misc Feature(22)2214..2216
Misc Feature(23)2214..2216
Misc Feature(24)2220..2222
Misc Feature(25)2259..2264
Misc Feature(26)2268..2273
Misc Feature(27)2268..2270
Misc Feature(28)2268..2270
Misc Feature(29)2271..2273
Misc Feature(30)2271..2273
Misc Feature(31)2298..2369
Misc Feature(32)2310..2312
Misc Feature(33)2313..2315
Misc Feature(34)2316..2318
Misc Feature(35)2331..2336
Misc Feature(36)2337..2342
Misc Feature(37)2337..2339
Misc Feature(38)2340..2342
Misc Feature(39)2355..2357
Misc Feature(40)2358..2363
Misc Feature(41)2358..2360
Misc Feature(42)2370..2498
Misc Feature(43)2370..2402
Misc Feature(44)2394..2453
Misc Feature(45)2415..2420
Misc Feature(46)2415..2417
Misc Feature(47)2427..2429
Misc Feature(48)2427..2429
Misc Feature(49)2427..2429
Misc Feature(50)2469..2471
Misc Feature(51)2469..2471
Misc Feature(52)2475..2486
Misc Feature(53)2484..2486
Misc Feature(54)2490..2492
Exon (1)1..257
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (2)258..425
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (3)426..555
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (4)556..668
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (5)669..862
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (6)863..1065
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (7)1066..1233
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (8)1234..1290
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (9)1291..1424
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (10)1425..1499
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (11)1500..1658
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (12)1659..1787
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (13)1788..1887
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (14)1888..2109
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (15)2110..2163
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (16)2164..2264
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (17)2265..2411
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Exon (18)2412..3633
Gene:APP
Gene Synonym:AAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Translation MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARD PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET KTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTN IKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(1)-dbSNP:
complement(1)-t, cdbSNP:200621906
complement(30)-t, gdbSNP:199610454
complement(41)-g, adbSNP:145958140
complement(45)-g, cdbSNP:45476095
complement(78)-g, cdbSNP:200990709
complement(90)-g, cdbSNP:459543
complement(107)-g, adbSNP:201528959
complement(157)-g, adbSNP:200289921
complement(177)-g, cdbSNP:199527632
complement(187)-g, cdbSNP:201509588
complement(190)-c, adbSNP:200339053
complement(246)-g, adbSNP:202070273
complement(258)-dbSNP:
complement(258)-t, cdbSNP:140350218
complement(289)-g, cdbSNP:55979514
complement(311)-g, adbSNP:55850639
complement(341)-g, adbSNP:200069013
complement(361)-g, adbSNP:56111408
complement(382)-t, cdbSNP:11549661
complement(386)-g, adbSNP:201970902
complement(388)-g, adbSNP:200648330
complement(408)-c, adbSNP:11549662
complement(426)-dbSNP:
complement(426)-t, cdbSNP:151188448
complement(498)-g, adbSNP:200347552
complement(499)-g, cdbSNP:199741007
complement(530)-t, gdbSNP:202145222
complement(551)-g, adbSNP:201537751
complement(575)-dbSNP:
complement(575)-g, adbSNP:142154215
complement(578)-g, adbSNP:200826437
complement(584)-g, adbSNP:148699407
complement(621)-t, cdbSNP:200086074
complement(626)-g, adbSNP:201724614
complement(627)-t, cdbSNP:200541360
complement(632)-g, adbSNP:199520480
complement(633)-t, cdbSNP:201573490
complement(646)-t, cdbSNP:200857049
complement(653)-g, adbSNP:41276552
complement(656)-g, adbSNP:199591984
complement(657)-t, cdbSNP:201454946
complement(662)-g, adbSNP:200398369
complement(682)-dbSNP:
complement(682)-t, cdbSNP:200892475
complement(685)-t, cdbSNP:200117824
complement(696)-g, adbSNP:201885206
complement(705)-t, cdbSNP:201102339
complement(722)-g, adbSNP:199905579
complement(723)-t, cdbSNP:201817335
complement(739)-c, adbSNP:200898059
complement(744)-t, cdbSNP:202108340
complement(762)-g, adbSNP:199744129
complement(781)-t, cdbSNP:201460828
complement(792)-g, adbSNP:145081708
complement(802)-g, adbSNP:149995579
complement(818)-t, cdbSNP:201022619
complement(853)-g, cdbSNP:201250681
complement(859)-g, cdbSNP:200283638
complement(872)-dbSNP:
complement(872)-t, adbSNP:200543884
complement(904)-g, adbSNP:139819006
complement(910)-c, adbSNP:201093867
complement(926)-g, adbSNP:200270161
complement(935)-g, adbSNP:201941279
complement(936)-t, cdbSNP:147485129
complement(941)-g, adbSNP:148832151
complement(942)-t, cdbSNP:200103591
complement(981)-g, adbSNP:201732035
complement(986)-g, adbSNP:140941257
complement(987)-t, cdbSNP:201094604
complement(1020)-t, cdbSNP:200159151
complement(1026)-t, adbSNP:202198008
complement(1029)-t, gdbSNP:149353279
complement(1030..1031)-, ggggdbSNP:147067229
complement(1056)-t, cdbSNP:200620364
complement(1085)-dbSNP:
complement(1085)-g, adbSNP:199890425
complement(1096)-g, adbSNP:202074408
complement(1097)-t, g, cdbSNP:201294669
complement(1110)-t, cdbSNP:200539466
complement(1117)-t, cdbSNP:202218688
complement(1163)-g, adbSNP:150676543
complement(1166)-g, adbSNP:200016837
complement(1175)-g, adbSNP:201622977
complement(1177..1178)-, cdbSNP:141526793
complement(1182)-g, adbSNP:200978018
complement(1212)-t, cdbSNP:200074159
complement(1217)-g, adbSNP:201462552
complement(1224)-t, cdbSNP:200727285
complement(1226)-g, adbSNP:199824159
complement(1230)-t, cdbSNP:201045185
complement(1235)-dbSNP:
complement(1235)-c, adbSNP:201715311
complement(1250)-g, cdbSNP:200438411
complement(1266)-g, adbSNP:201792381
complement(1275)-g, cdbSNP:200772442
complement(1288)-t, adbSNP:200154785
complement(1323)-dbSNP:
complement(1323)-t, cdbSNP:141331202
complement(1337)-g, cdbSNP:199526286
complement(1345)-, gdbSNP:34725003
complement(1410)-g, cdbSNP:201668897
complement(1415)-t, cdbSNP:201739783
complement(1453)-dbSNP:
complement(1453)-t, cdbSNP:200487832
complement(1486)-t, cdbSNP:188433801
complement(1491)-g, cdbSNP:141941701
complement(1505)-dbSNP:
complement(1505)-g, adbSNP:148180403
complement(1508)-g, cdbSNP:199713404
complement(1562)-t, cdbSNP:201958273
complement(1605)-g, adbSNP:200548072
complement(1606)-t, cdbSNP:199549173
complement(1608)-g, adbSNP:201227886
complement(1609)-t, cdbSNP:182162117
complement(1615)-g, cdbSNP:199641588
complement(1616)-g, adbSNP:201377759
complement(1634)-g, adbSNP:200601478
complement(1635)-c, adbSNP:143794560
complement(1638..1639)-, agdbSNP:71798026
complement(1656)-t, gdbSNP:201085152
complement(1657)-t, cdbSNP:200268317
complement(1658)-t, cdbSNP:202013285
complement(1663)-dbSNP:
complement(1663)-t, cdbSNP:200587958
complement(1682)-t, cdbSNP:199630906
complement(1686)-t, gdbSNP:201384815
complement(1687)-t, cdbSNP:200735206
complement(1697)-g, adbSNP:199681584
complement(1698)-t, cdbSNP:201547994
complement(1701)-g, adbSNP:45588932
complement(1766)-t, cdbSNP:200663376
complement(1770)-t, cdbSNP:199521746
complement(1780)-t, cdbSNP:201466202
complement(1782)-g, adbSNP:113145702
complement(1784)-g, adbSNP:200335109
complement(1814)-t, cdbSNP:45537238
complement(1818)-g, adbSNP:200500889
complement(1841)-t, cdbSNP:199860711
complement(1850)-g, adbSNP:201877705
complement(1865)-g, adbSNP:200846684
complement(1880)-t, adbSNP:201031674
complement(1884)-t, cdbSNP:199586073
complement(1889)-dbSNP:
complement(1889)-g, adbSNP:137865262
complement(1890)-g, cdbSNP:200521782
complement(1922)-g, adbSNP:201794320
complement(1926)-t, cdbSNP:200769792
complement(1946)-g, adbSNP:201221707
complement(1951)-g, cdbSNP:145371658
complement(1970)-g, adbSNP:200150248
complement(1971)-t, cdbSNP:201874897
complement(1976)-t, adbSNP:201264568
complement(1987)-t, gdbSNP:199905452
complement(1994)-g, adbSNP:201817181
complement(1995)-t, cdbSNP:140304729
complement(1999)-g, adbSNP:200088099
complement(2000)-t, cdbSNP:138434918
complement(2001)-t, cdbSNP:201724379
complement(2009)-g, adbSNP:150151009
complement(2010)-t, cdbSNP:199887707
complement(2027)-g, cdbSNP:201858248
complement(2033)-t, cdbSNP:200922667
complement(2040)-t, cdbSNP:112263157
complement(2049)-t, cdbSNP:201479601
complement(2054)-g, adbSNP:200539821
complement(2067)-g, adbSNP:199761619
complement(2081)-g, adbSNP:201160106
complement(2128)-dbSNP:
complement(2128)-t, cdbSNP:151010236
complement(2138)-g, adbSNP:145273675
complement(2141)-t, g, adbSNP:201038323
complement(2156)-g, adbSNP:199932473
complement(2171)-dbSNP:
complement(2171)-t, cdbSNP:141559720
complement(2182)-g, adbSNP:201104127
complement(2188)-g, adbSNP:200260102
complement(2193)-t, cdbSNP:201945946
2195+c, gdbSNP:63750363
complement(2196)-t, adbSNP:200084346
complement(2198)-g, adbSNP:147868600
complement(2207)-t, cdbSNP:144605371
2210..2211+ga, tcdbSNP:281865161
2217+a, gdbSNP:63750847
2218+c, tdbSNP:193922916
2230+a, gdbSNP:63749953
2232+a, gdbSNP:63750064
complement(2239)-g, c, adbSNP:148754993
complement(2261)-t, cdbSNP:199820754
complement(2270)-dbSNP:
complement(2270)-t, gdbSNP:201724975
2275+c, gdbSNP:63750671
2277+a, c, gdbSNP:63750579
2278+a, gdbSNP:63751039
2280+a, gdbSNP:63749810
2313+c, gdbSNP:63750921
complement(2315)-g, adbSNP:200388443
complement(2324)-g, adbSNP:148888161
complement(2325)-t, cdbSNP:201269325
complement(2328)-t, cdbSNP:200446085
complement(2333)-t, gdbSNP:116650065
2337+a, gdbSNP:63750066
2338+c, tdbSNP:1800557
2340+a, gdbSNP:63750643
2341+c, tdbSNP:63750973
2343+a, gdbSNP:63750734
2344+c, tdbSNP:63750868
2345+a, gdbSNP:63750627
2346+a, gdbSNP:63750399
2347+c, tdbSNP:63750851
complement(2348)-t, g, adbSNP:145564988
2349+a, c, g, tdbSNP:63750264
2350+g, tdbSNP:63749964
2368+c, tdbSNP:63751122
2372+c, gdbSNP:63750151
complement(2390)-g, cdbSNP:201020743
complement(2417)-dbSNP:
complement(2417)-g, adbSNP:145277462
complement(2420)-g, adbSNP:201411134
complement(2440)-t, cdbSNP:200396597
complement(2465)-g, adbSNP:142218254
complement(2486)-g, adbSNP:139004544
complement(2496)-c, adbSNP:78280744
complement(2520)-t, cdbSNP:201922766
complement(2524)-g, adbSNP:201602257
complement(2531)-g, adbSNP:201729239
complement(2557)-c, adbSNP:200487986
complement(2609)-g, cdbSNP:202204121
complement(2611)-t, cdbSNP:200773744
complement(2621)-c, adbSNP:200154864
complement(2668)-g, adbSNP:113174916
complement(2684)-g, adbSNP:201876780
complement(2691)-t, cdbSNP:200917677
complement(2707)-t, gdbSNP:199977643
complement(2711)-g, adbSNP:201644219
complement(2713)-g, cdbSNP:201380777
complement(2776)-t, cdbSNP:200058308
complement(2777)-t, adbSNP:201729905
complement(2787)-t, cdbSNP:200591716
complement(2802)-g, adbSNP:199534609
complement(2803)-g, adbSNP:201853089
complement(2884)-g, adbSNP:200736438
complement(2885)-t, cdbSNP:187940037
complement(2892)-c, adbSNP:201377891
complement(2900)-g, cdbSNP:200600383
complement(2917)-t, adbSNP:199765959
complement(2924)-t, cdbSNP:150007519
complement(2927)-t, cdbSNP:200262591
complement(2947)-t, cdbSNP:201624429
complement(2962)-, adbSNP:71698734
complement(2964)-g, adbSNP:200980048
complement(2967)-t, cdbSNP:200492624
complement(2973)-t, cdbSNP:202194773
complement(2975)-t, cdbSNP:200981079
complement(2987)-g, adbSNP:182834675
complement(3002)-t, cdbSNP:199862130
complement(3027)-t, adbSNP:201887246
complement(3071)-g, adbSNP:191651536
complement(3096)-t, adbSNP:201034704
complement(3103)-t, c, adbSNP:45455403
complement(3116)-t, cdbSNP:139278773
complement(3131)-t, cdbSNP:201008117
complement(3137)-t, cdbSNP:199680232
complement(3163)-g, adbSNP:11549660
complement(3190)-g, c, adbSNP:201961275
complement(3208)-g, adbSNP:200665110
complement(3215)-t, gdbSNP:199549432
complement(3230)-g, c, adbSNP:186409009
complement(3232)-g, adbSNP:200286647
complement(3234)-c, adbSNP:199700901
complement(3237)-g, adbSNP:146774213
complement(3247)-g, cdbSNP:200603813
complement(3248)-t, cdbSNP:202132811
complement(3251)-g, adbSNP:201621005
complement(3260)-g, cdbSNP:200259364
complement(3261)-c, adbSNP:201942871
complement(3289)-t, gdbSNP:183019783
complement(3291)-t, cdbSNP:200089634
complement(3305)-t, cdbSNP:202057479
complement(3307)-g, adbSNP:200985813
complement(3310)-g, adbSNP:199885985
complement(3330)-g, adbSNP:201885383
complement(3331)-t, gdbSNP:200853376
complement(3337)-t, cdbSNP:199963586
complement(3346)-c, adbSNP:3200120
complement(3350)-g, adbSNP:201382660
complement(3366)-t, adbSNP:200692470
complement(3371)-t, adbSNP:199762023
complement(3376)-t, gdbSNP:201611727
complement(3381)-g, adbSNP:190880668
complement(3412)-t, gdbSNP:199500588
complement(3417)-t, adbSNP:201539056
complement(3421)-t, gdbSNP:200379862
complement(3426)-g, cdbSNP:202081585
complement(3427)-g, adbSNP:736479
complement(3438)-c, adbSNP:200452592
complement(3450)-g, adbSNP:1059461
complement(3478)-g, cdbSNP:202141287
complement(3480)-g, adbSNP:45541739
complement(3507)-, tdbSNP:35871145
complement(3526)-g, adbSNP:199902897
complement(3528)-c, adbSNP:202108412
complement(3537)-t, cdbSNP:201019734
complement(3543)-g, cdbSNP:200053802
complement(3562)-c, adbSNP:201471700
complement(3571)-g, adbSNP:1059478
complement(3572)-t, cdbSNP:200544221
complement(3574)-t, cdbSNP:199913244
complement(3616)-c, adbSNP:201838604
complement(3631)-t, cdbSNP:112973660
Gene SymbolAPP
Gene SynonymAAA; ABETA; ABPP; AD1; APPI; CTFgamma; CVAP; PN-II; PN2
Chromosome21
Locus Map21q21.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000484 Homo sapiens amyloid beta (A4) precursor protein (APP), transcript variant 1, mRNA. Full Length $1276.80
ORF Sequence $670.77
NM_001136016 Homo sapiens amyloid beta (A4) precursor protein (APP), transcript variant 4, mRNA. Full Length $1250.20
ORF Sequence $649.89
NM_001136129 Homo sapiens amyloid beta (A4) precursor protein (APP), transcript variant 5, mRNA. Full Length $1139.25
ORF Sequence $556.80
NM_001136130 Homo sapiens amyloid beta (A4) precursor protein (APP), transcript variant 6, mRNA. Full Length $1218.00
ORF Sequence $622.05
NM_001136131 Homo sapiens amyloid beta (A4) precursor protein (APP), transcript variant 7, mRNA. Full Length $1158.50
ORF Sequence $575.07
NM_001204301 Homo sapiens amyloid beta (A4) precursor protein (APP), transcript variant 8, mRNA. Full Length $1257.90
ORF Sequence $655.11
NM_001204302 Homo sapiens amyloid beta (A4) precursor protein (APP), transcript variant 9, mRNA. Full Length $1237.95
ORF Sequence $638.58
NM_001204303 Homo sapiens amyloid beta (A4) precursor protein (APP), transcript variant 10, mRNA. Full Length $1179.15
ORF Sequence $589.86
NM_201413 Homo sapiens amyloid beta (A4) precursor protein (APP), transcript variant 2, mRNA. Full Length $1256.85
ORF Sequence $654.24
NM_201414 Homo sapiens amyloid beta (A4) precursor protein (APP), transcript variant 3, mRNA. Full Length $1198.05
ORF Sequence $605.52
Title Levels of soluble apolipoprotein E/amyloid-beta (Abeta) complex are reduced and oligomeric Abeta increased with APOE4 and Alzheimer disease in a transgenic mouse model and human samples .
Author Tai,L.M., Bilousova,T., Jungbauer,L., Roeske,S.K., Youmans,K.L., Yu,C., Poon,W.W., Cornwell,L.B., Miller,C.A., Vinters,H.V., Van Eldik,L.J., Fardo,D.W., Estus,S., Bu,G., Gylys,K.H. and Ladu,M.J.
Journal J. Biol. Chem. 288 (8), 5914-5926 (2013)
Title Endothelin-converting enzymes degrade intracellular beta-amyloid produced within the endosomal/lysosomal pathway and autophagosomes .
Author Pacheco-Quinto,J. and Eckman,E.A.
Journal J. Biol. Chem. 288 (8), 5606-5615 (2013)
Title The elevated copper binding strength of amyloid-beta aggregates allows the sequestration of copper from albumin: a pathway to accumulation of copper in senile plaques .
Author Jiang,D., Zhang,L., Grant,G.P., Dudzik,C.G., Chen,S., Patel,S., Hao,Y., Millhauser,G.L. and Zhou,F.
Journal Biochemistry 52 (3), 547-556 (2013)
Title Amyloid-beta oligomerization in Alzheimer dementia versus high-pathology controls .
Author Esparza,T.J., Zhao,H., Cirrito,J.R., Cairns,N.J., Bateman,R.J., Holtzman,D.M. and Brody,D.L.
Journal Ann. Neurol. 73 (1), 104-119 (2013)
Title [Compensatory mechanisms to heal neuroplasticity impairment under Alzheiemer's disease neurodegeneration. I: The role of amyloid beta and its' precursor protein] .
Author Kudinov,A.R., Kudinova,N.V., Kezlia,E.V., Kozyrev,K.M., Medvedev,A.E. and Berezov,T.T.
Journal Biomed Khim 58 (4), 385-399 (2012)
Title More missense in amyloid gene .
Author Carter,D.A., Desmarais,E., Bellis,M., Campion,D., Clerget-Darpoux,F., Brice,A., Agid,Y., Jaillard-Serradt,A. and Mallet,J.
Journal Nat. Genet. 2 (4), 255-256 (1992)
Title Schizophrenia scepticism .
Author Mant,R., Asherson,P., Gill,M., McGuffin,P., Owen,M., Wert,S.E., Gregory,R.J., Smith,A.E., Cohn,J.A., Wilson,J.M. et al.
Journal Nat. Genet. 2 (1), 12 (1992)
Title A pathogenic mutation for probable Alzheimer's disease in the APP gene at the N-terminus of beta-amyloid .
Author Mullan,M., Crawford,F., Axelman,K., Houlden,H., Lilius,L., Winblad,B. and Lannfelt,L.
Journal Nat. Genet. 1 (5), 345-347 (1992)
Title Mutation in codon 713 of the beta amyloid precursor protein gene presenting with schizophrenia .
Author Jones,C.T., Morris,S., Yates,C.M., Moffoot,A., Sharpe,C., Brock,D.J. and St Clair,D.
Journal Nat. Genet. 1 (4), 306-309 (1992)
Title Presenile dementia and cerebral haemorrhage linked to a mutation at codon 692 of the beta-amyloid precursor protein gene .
Author Hendriks,L., van Duijn,C.M., Cras,P., Cruts,M., Van Hul,W., van Harskamp,F., Warren,A., McInnis,M.G., Antonarakis,S.E., Martin,J.J. et al.
Journal Nat. Genet. 1 (3), 218-221 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878