• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens coagulation factor II (thrombin) (F2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000506 Homo sapiens coagulation factor II (thrombin) (F2), mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_000506.3, 169808403
Length 2018 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens coagulation factor II (thrombin) (F2), mRNA.
Product prothrombin preproprotein
Comment

Summary: Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life. Mutations in F2 leads to various forms of thrombosis and dysprothrombinemia. [provided by RefSeq, Jul 2008].

RefSeq NP_000497.1
CDS 44..1912
Misc Feature(1)35..37
Misc Feature(2)116..307
Misc Feature(3)188..190
Misc Feature(4)188..190
Misc Feature(5)191..193
Misc Feature(6)191..193
Misc Feature(7)212..214
Misc Feature(8)212..214
Misc Feature(9)218..220
Misc Feature(10)218..220
Misc Feature(11)227..229
Misc Feature(12)227..229
Misc Feature(13)230..232
Misc Feature(14)230..232
Misc Feature(15)245..247
Misc Feature(16)245..247
Misc Feature(17)248..250
Misc Feature(18)248..250
Misc Feature(19)257..259
Misc Feature(20)257..259
Misc Feature(21)266..268
Misc Feature(22)266..268
Misc Feature(23)356..601
Misc Feature(24)392..394
Misc Feature(25)404..406
Misc Feature(26)order(437..439,467..469,545..547,551..553,575..577)
Misc Feature(27)470..472
Misc Feature(28)635..640
Misc Feature(29)635..637
Misc Feature(30)674..919
Misc Feature(31)707..709
Misc Feature(32)order(752..754,794..796,860..862,866..868,890..892)
Misc Feature(33)983..985
Misc Feature(34)986..1132
Misc Feature(35)1022..1027
Misc Feature(36)1022..1024
Misc Feature(37)1130..1882
Misc Feature(38)1130..1135
Misc Feature(39)1133..1891
Misc Feature(40)1133..1135
Misc Feature(41)order(1259..1261,1427..1429,1745..1747)
Misc Feature(42)1349..1351
Misc Feature(43)1694..1762
Misc Feature(44)order(1727..1729,1808..1810,1814..1816)
Exon (1)1..122
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (2)123..283
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (3)284..308
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (4)309..359
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (5)360..465
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (6)466..602
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (7)603..917
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (8)918..1046
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (9)1047..1173
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (10)1174..1341
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (11)1342..1515
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (12)1516..1697
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (13)1698..1768
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (14)1769..2010
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Translation MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY GFYTHVFRLKKWIQKVIDQFGE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
7+dbSNP:
7+a, tdbSNP:184828110
146+dbSNP:
146+c, tdbSNP:144785536
151+a, gdbSNP:148596790
216+a, gdbSNP:368162633
223+c, tdbSNP:374353447
234+c, tdbSNP:142001812
235+a, gdbSNP:147253030
256+c, tdbSNP:371680056
276+a, c, tdbSNP:200934494
277+a, gdbSNP:151121282
302+dbSNP:
302+c, tdbSNP:144736001
304+c, tdbSNP:201347110
327+dbSNP:
327+c, tdbSNP:189436668
328+a, gdbSNP:147892497
333+a, gdbSNP:200904690
414+dbSNP:
414+a, gdbSNP:139148365
423+a, tdbSNP:368221335
446+c, tdbSNP:372312087
493+dbSNP:
493+c, tdbSNP:371923575
494+a, gdbSNP:149943083
505..506+, tdbSNP:387906522
523+c, tdbSNP:3136452
524+a, gdbSNP:374766750
537+c, tdbSNP:5896
538+a, gdbSNP:144857547
544+c, gdbSNP:369468882
567+c, tdbSNP:371627939
624+dbSNP:
624+c, tdbSNP:202067051
625+a, gdbSNP:376545041
635+c, tdbSNP:146671243
641+a, gdbSNP:62623459
691+a, tdbSNP:145352722
692+c, tdbSNP:200969932
714+a, gdbSNP:200525645
715+c, tdbSNP:141553765
740+a, cdbSNP:369762180
749+a, gdbSNP:148020569
761+a, gdbSNP:141678604
777+, tdbSNP:193920779
841+c, tdbSNP:138260543
856+c, tdbSNP:5899
857+a, gdbSNP:199558597
858+c, tdbSNP:17854684
886+c, tdbSNP:147699032
892+c, tdbSNP:200038743
922+dbSNP:
922+a, gdbSNP:201549417
925+c, tdbSNP:370819135
926+a, gdbSNP:139045365
971+a, gdbSNP:375348035
976+c, tdbSNP:377529931
977+a, gdbSNP:371085757
983+c, tdbSNP:121918477
1021+a, gdbSNP:142949009
1035+c, tdbSNP:200812621
1036+a, gdbSNP:375641046
1070+dbSNP:
1070+a, gdbSNP:121918483
1097+a, gdbSNP:121918484
1126+c, tdbSNP:367827038
1146+c, tdbSNP:371281053
1156+a, gdbSNP:375038453
1180+dbSNP:
1180+a, gdbSNP:112119641
1182+c, tdbSNP:121918481
1190+c, tdbSNP:147456134
1199+a, cdbSNP:5897
1255+c, tdbSNP:148544390
1276+a, gdbSNP:5898
1297+a, cdbSNP:375752222
1316+c, tdbSNP:121918479
1317+a, gdbSNP:121918485
1320+c, tdbSNP:150569436
1335+a, gdbSNP:121918482
1339+a, cdbSNP:1130873
1345+dbSNP:
1345+a, cdbSNP:201030466
1409+c, tdbSNP:139552841
1410+a, gdbSNP:143498218
1424+c, tdbSNP:121918478
1425+a, gdbSNP:373346034
1454+c, gdbSNP:377462682
1456+c, tdbSNP:200144348
1506+c, tdbSNP:202076180
1507+a, gdbSNP:146742525
1519+dbSNP:
1519+a, gdbSNP:375684674
1542+a, gdbSNP:202003146
1572+c, tdbSNP:140404878
1579+a, gdbSNP:377628196
1584+a, gdbSNP:144011338
1585+a, cdbSNP:199772906
1590+g, tdbSNP:144885724
1644+c, tdbSNP:201541084
1645+a, c, gdbSNP:5900
1671+g, tdbSNP:143064939
1678+g, tdbSNP:200301868
1797+dbSNP:
1797+c, tdbSNP:370229832
1804+c, tdbSNP:148144570
1828+c, gdbSNP:121918486
1830+g, tdbSNP:387907201
1835+c, gdbSNP:376551872
1845+g, tdbSNP:121918480
1846+c, tdbSNP:374039582
1858+c, tdbSNP:368442575
1865+c, tdbSNP:142495261
1867+c, tdbSNP:3136532
1883+a, cdbSNP:74616944
1900+a, gdbSNP:113406770
1921+g, tdbSNP:201577861
1958+a, tdbSNP:188001809
2008+c, tdbSNP:72550707
2009+a, gdbSNP:1799963
Gene SymbolF2
Gene SynonymPT; RPRGL2; THPH1
Chromosome11
Locus Map11p11
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000506 Homo sapiens coagulation factor II (thrombin) (F2), mRNA. On-demand $849.00 20
Title A deep vein thrombosis caused by 20209C>T mutation in homozygosis of the prothrombin gene in a Caucasian patient .
Author Alvarez SI, Ollero EB, Llinares Sanjuan FM, Martinez FL and Calvo Martin MT.
Journal Biochem Med (Zagreb) 24 (1), 159-166 (2014)
Title Mesenteric vein thrombosis in a patient heterozygous for factor V Leiden and G20210A prothrombin genotypes .
Author Karmacharya P, Aryal MR and Donato A.
Journal World J. Gastroenterol. 19 (43), 7813-7815 (2013)
Title Protease-activated receptor 1 (PAR1) and PAR4 heterodimers are required for PAR1-enhanced cleavage of PAR4 by alpha-thrombin .
Author Arachiche A, Mumaw MM, de la Fuente M and Nieman MT.
Journal J. Biol. Chem. 288 (45), 32553-32562 (2013)
Title [The 20210G>A and 19911A>G polymorphisms of prothrombin gene and recurrent miscarriages] .
Author Barlik M, Seremak-Mrozikiewicz A, Krasnik W and Drews K.
Journal Ginekol. Pol. 84 (10), 830-834 (2013)
Title [Investigation of interaction of thrombin-binding aptamer with thrombin and prethrombin-2 by simulation of molecular dynamics] .
Author Shcherbinin,D.S. and Veselovslii,A.V.
Journal Biofizika 58 (3), 415-424 (2013)
Title Prothrombin-Related Thrombophilia .
Author Kujovich,J.L.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Molecular and genetic analysis of a compound heterozygote for dysprothrombinemia of prothrombin Tokushima and hypoprothrombinemia .
Author Iwahana H, Yoshimoto K, Shigekiyo T, Shirakami A, Saito S and Itakura M.
Journal Am. J. Hum. Genet. 51 (6), 1386-1395 (1992)
Title Prothrombin Quick. A newly identified dysprothrombinemia .
Author Owen,C.A. Jr., Henriksen,R.A., McDuffie,F.C. and Mann,K.G.
Journal Mayo Clin. Proc. 53 (1), 29-33 (1978)
Title Primary structure of human prethrombin 2 and alpha-thrombin .
Author Butkowski,R.J., Elion,J., Downing,M.R. and Mann,K.G.
Journal J. Biol. Chem. 252 (14), 4942-4957 (1977)
Title Amino acid sequence of human prothrombin fragments 1 and 2 .
Author Walz,D.A., Hewett-Emmett,D. and Seegers,W.H.
Journal Proc. Natl. Acad. Sci. U.S.A. 74 (5), 1969-1972 (1977)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.