• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens coagulation factor II (thrombin) (F2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000506 Homo sapiens coagulation factor II (thrombin) (F2), mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_000506.3, 169808403
Length 2018 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens coagulation factor II (thrombin) (F2), mRNA.
Product prothrombin preproprotein
Comment

Summary: Coagulation factor II is proteolytically cleaved to form thrombin in the first step of the coagulation cascade which ultimately results in the stemming of blood loss. F2 also plays a role in maintaining vascular integrity during development and postnatal life. Mutations in F2 leads to various forms of thrombosis and dysprothrombinemia. [provided by RefSeq, Jul 2008].

RefSeq NP_000497.1
CDS 44..1912
Misc Feature(1)35..37
Misc Feature(2)116..307
Misc Feature(3)188..190
Misc Feature(4)188..190
Misc Feature(5)191..193
Misc Feature(6)191..193
Misc Feature(7)212..214
Misc Feature(8)212..214
Misc Feature(9)218..220
Misc Feature(10)218..220
Misc Feature(11)227..229
Misc Feature(12)227..229
Misc Feature(13)230..232
Misc Feature(14)230..232
Misc Feature(15)245..247
Misc Feature(16)245..247
Misc Feature(17)248..250
Misc Feature(18)248..250
Misc Feature(19)257..259
Misc Feature(20)257..259
Misc Feature(21)266..268
Misc Feature(22)266..268
Misc Feature(23)356..601
Misc Feature(24)392..394
Misc Feature(25)404..406
Misc Feature(26)order(437..439,467..469,545..547,551..553,575..577)
Misc Feature(27)470..472
Misc Feature(28)635..640
Misc Feature(29)635..637
Misc Feature(30)674..919
Misc Feature(31)707..709
Misc Feature(32)order(752..754,782..784,860..862,866..868,890..892)
Misc Feature(33)983..985
Misc Feature(34)986..1132
Misc Feature(35)1022..1027
Misc Feature(36)1022..1024
Misc Feature(37)1130..1135
Misc Feature(38)1133..1891
Misc Feature(39)1133..1135
Misc Feature(40)order(1259..1261,1427..1429,1745..1747)
Misc Feature(41)1349..1351
Misc Feature(42)1694..1762
Misc Feature(43)order(1727..1729,1808..1810,1814..1816)
Exon (1)1..122
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (2)123..283
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (3)284..308
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (4)309..359
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (5)360..465
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (6)466..602
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (7)603..917
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (8)918..1046
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (9)1047..1173
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (10)1174..1341
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (11)1342..1515
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (12)1516..1697
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (13)1698..1768
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Exon (14)1769..2010
Gene:F2
Gene Synonym:PT; RPRGL2; THPH1
Translation MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY GFYTHVFRLKKWIQKVIDQFGE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
7+dbSNP:
7+a, tdbSNP:184828110
146+dbSNP:
146+c, tdbSNP:144785536
151+a, gdbSNP:148596790
234+c, tdbSNP:142001812
235+a, gdbSNP:147253030
276+c, tdbSNP:200934494
277+a, gdbSNP:151121282
302+dbSNP:
302+c, tdbSNP:144736001
304+c, tdbSNP:201347110
327+dbSNP:
327+c, tdbSNP:189436668
328+a, gdbSNP:147892497
333+a, gdbSNP:200904690
414+dbSNP:
414+a, gdbSNP:139148365
494+dbSNP:
494+a, gdbSNP:149943083
523+c, tdbSNP:3136452
537+c, tdbSNP:5896
538+a, gdbSNP:144857547
624+dbSNP:
624+c, tdbSNP:202067051
635+c, tdbSNP:146671243
641+a, gdbSNP:62623459
691+a, tdbSNP:145352722
692+c, tdbSNP:200969932
714+a, gdbSNP:200525645
715+c, tdbSNP:141553765
749+a, gdbSNP:148020569
761+a, gdbSNP:141678604
777+, tdbSNP:193920779
834+a, gdbSNP:150465568
841+c, tdbSNP:138260543
856+c, tdbSNP:5899
857+a, gdbSNP:199558597
858+c, tdbSNP:17854684
886+c, tdbSNP:147699032
892+c, tdbSNP:200038743
922+dbSNP:
922+a, gdbSNP:201549417
926+a, gdbSNP:139045365
983+c, tdbSNP:121918477
1021+a, gdbSNP:142949009
1035+c, tdbSNP:200812621
1070+dbSNP:
1070+a, gdbSNP:121918483
1097+a, gdbSNP:121918484
1180+dbSNP:
1180+a, gdbSNP:112119641
1182+c, tdbSNP:121918481
1190+c, tdbSNP:147456134
1199+a, cdbSNP:5897
1255+c, tdbSNP:148544390
1276+a, gdbSNP:5898
1316+c, tdbSNP:121918479
1317+a, gdbSNP:121918485
1320+c, tdbSNP:150569436
1335+a, gdbSNP:121918482
1339+a, cdbSNP:1130873
1345+dbSNP:
1345+a, cdbSNP:201030466
1409+c, tdbSNP:139552841
1410+a, gdbSNP:143498218
1424+c, tdbSNP:121918478
1456+c, tdbSNP:200144348
1506+c, tdbSNP:202076180
1507+a, gdbSNP:146742525
1542+dbSNP:
1542+a, gdbSNP:202003146
1572+c, tdbSNP:140404878
1584+a, gdbSNP:144011338
1585+a, cdbSNP:199772906
1590+g, tdbSNP:144885724
1644+c, tdbSNP:201541084
1645+a, c, gdbSNP:5900
1671+g, tdbSNP:143064939
1678+g, tdbSNP:200301868
1804+dbSNP:
1804+c, tdbSNP:148144570
1828+c, gdbSNP:121918486
1845+g, tdbSNP:121918480
1865+c, tdbSNP:142495261
1867+c, tdbSNP:3136532
1883+a, cdbSNP:74616944
1900+a, gdbSNP:113406770
1921+g, tdbSNP:201577861
1958+a, tdbSNP:188001809
2008+c, tdbSNP:72550707
2009+a, gdbSNP:1799963
Gene SymbolF2
Gene SynonymPT; RPRGL2; THPH1
Chromosome11
Locus Map11p11
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000506 Homo sapiens coagulation factor II (thrombin) (F2), mRNA. On-demand $849.00 20
Title Enhanced effector function of CD8(+) T cells from healthy controls and HIV-infected patients occurs through thrombin activation of protease-activated receptor 1 .
Author Hurley,A., Smith,M., Karpova,T., Hasley,R.B., Belkina,N., Shaw,S., Balenga,N., Druey,K.M., Nickel,E., Packard,B., Imamichi,H., Hu,Z., Follmann,D., McNally,J., Higgins,J., Sneller,M., Lane,H.C. and Catalfamo,M.
Journal J. Infect. Dis. 207 (4), 638-650 (2013)
Title Thrombin-cleaved fragments of osteopontin are overexpressed in malignant glial tumors and provide a molecular niche with survival advantage .
Author Yamaguchi,Y., Shao,Z., Sharif,S., Du,X.Y., Myles,T., Merchant,M., Harsh,G., Glantz,M., Recht,L., Morser,J. and Leung,L.L.
Journal J. Biol. Chem. 288 (5), 3097-3111 (2013)
Title Anticoagulant activity of a unique sulfated pyranosic (1->3)-beta-L-arabinan through direct interaction with thrombin .
Author Fernandez,P.V., Quintana,I., Cerezo,A.S., Caramelo,J.J., Pol-Fachin,L., Verli,H., Estevez,J.M. and Ciancia,M.
Journal J. Biol. Chem. 288 (1), 223-233 (2013)
Title Prothrombotic polymorphisms in patients with Raynaud's phenomenon and migraine .
Author Takats,A.T., Shemirani,A.H., Zsori,K.S., Andras,C. and Csiki,Z.
Journal Acta Physiol Hung 99 (4), 430-435 (2012)
Title Inherited thrombophilia with recurrent pregnancy loss in Turkish women--a real phenomenon? .
Author Yildiz,G., Yavuzcan,A., Yildiz,P., Suer,N. and Tandogan,N.
Journal Ginekol. Pol. 83 (8), 598-603 (2012)
Title Molecular and genetic analysis of a compound heterozygote for dysprothrombinemia of prothrombin Tokushima and hypoprothrombinemia .
Author Iwahana,H., Yoshimoto,K., Shigekiyo,T., Shirakami,A., Saito,S. and Itakura,M.
Journal Am. J. Hum. Genet. 51 (6), 1386-1395 (1992)
Title Detection of a single base substitution of the gene for prothrombin Tokushima. The application of PCR-SSCP for the genetic and molecular analysis of dysprothrombinemia .
Author Iwahana,H., Yoshimoto,K., Shigekiyo,T., Shirakami,A., Saito,S. and Itakura,M.
Journal Int. J. Hematol. 55 (1), 93-100 (1992)
Title Prothrombin Quick. A newly identified dysprothrombinemia .
Author Owen,C.A. Jr., Henriksen,R.A., McDuffie,F.C. and Mann,K.G.
Journal Mayo Clin. Proc. 53 (1), 29-33 (1978)
Title Primary structure of human prethrombin 2 and alpha-thrombin .
Author Butkowski,R.J., Elion,J., Downing,M.R. and Mann,K.G.
Journal J. Biol. Chem. 252 (14), 4942-4957 (1977)
Title Amino acid sequence of human prothrombin fragments 1 and 2 .
Author Walz,D.A., Hewett-Emmett,D. and Seegers,W.H.
Journal Proc. Natl. Acad. Sci. U.S.A. 74 (5), 1969-1972 (1977)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.