• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibrinogen alpha chain (FGA), transcript variant alpha-E, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000508 Homo sapiens fibrinogen alpha chain (FGA), transcript variant alpha-E, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_000508.3, 70906432
Length 3655 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens fibrinogen alpha chain (FGA), transcript variant alpha-E, mRNA.
Product fibrinogen alpha chain isoform alpha-E preproprotein
Comment

Summary: The protein encoded by this gene is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in two isoforms which vary in the carboxy-terminus. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (alpha-E) represents the longer transcript and encodes the longer isoform (alpha-E).

RefSeq NP_000499.1
CDS 59..2659
Misc Feature(1)122..124
Misc Feature(2)122..124
Misc Feature(3)161..166
Misc Feature(4)164..172
Misc Feature(5)200..616
Misc Feature(6)356..361
Misc Feature(7)419..424
Misc Feature(8)425..430
Misc Feature(9)887..889
Misc Feature(10)1148..1150
Misc Feature(11)1292..1294
Misc Feature(12)1391..1588
Misc Feature(13)order(1439..1441,1529..1531)
Misc Feature(14)1751..1753
Misc Feature(15)1829..1831
Misc Feature(16)1883..1885
Misc Feature(17)1946..2647
Misc Feature(18)2312..2314
Misc Feature(19)order(2429..2431,2435..2437,2441..2443)
Misc Feature(20)order(2453..2455,2462..2467,2492..2497)
Exon (1)1..112
Gene:FGA
Gene Synonym:Fib2
Exon (2)113..238
Gene:FGA
Gene Synonym:Fib2
Exon (3)239..422
Gene:FGA
Gene Synonym:Fib2
Exon (4)423..568
Gene:FGA
Gene Synonym:Fib2
Exon (5)569..1949
Gene:FGA
Gene Synonym:Fib2
Exon (6)1950..3655
Gene:FGA
Gene Synonym:Fib2
Translation MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDW NYKCPSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSA NNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSC RGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIKMKPVPDLVPGNFKSQ LQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSS GPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTW NPGSSERGSAGHWTSESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNV SPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTK EVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEF VSETESRGSESGIFTNTKESSSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKS YKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFS VYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQR GSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSH NNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENG VVWVSFRGADYSLRAVRMKIRPLVTQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
1+dbSNP:
1+a, gdbSNP:2070011
complement(37)-t, cdbSNP:149887756
complement(72)-t, cdbSNP:370674653
complement(74)-t, cdbSNP:386556283
complement(74)-g, adbSNP:2070025
complement(77)-t, cdbSNP:184672247
134+dbSNP:
134+a, gdbSNP:121909604
150+g, tdbSNP:121909605
161+c, tdbSNP:121909606
162+a, gdbSNP:121909607
168+c, tdbSNP:121909609
170+a, gdbSNP:121909608
174+a, tdbSNP:121909614
complement(186)-t, cdbSNP:374076087
complement(211)-g, adbSNP:143369046
complement(247)-dbSNP:
complement(247)-t, cdbSNP:373473045
complement(262)-g, adbSNP:111594488
complement(275)-g, adbSNP:369292888
complement(295)-t, cdbSNP:375985958
complement(302)-t, gdbSNP:199554805
complement(306)-t, cdbSNP:186283932
321+a, tdbSNP:77531839
complement(322)-g, adbSNP:200812094
complement(358)-t, cdbSNP:112877216
complement(370)-t, cdbSNP:201709083
complement(371)-g, adbSNP:147070445
complement(403)-g, adbSNP:141623466
complement(461)-dbSNP:
complement(461)-t, cdbSNP:147888314
complement(485)-g, adbSNP:375489804
complement(494)-t, cdbSNP:372161622
complement(508)-t, cdbSNP:368446857
complement(533)-t, cdbSNP:199828049
complement(590)-dbSNP:
complement(590)-g, adbSNP:140911890
complement(599)-g, adbSNP:199717989
complement(600)-t, cdbSNP:370628018
complement(603)-g, cdbSNP:151016432
complement(611)-t, cdbSNP:372283429
complement(665)-g, adbSNP:200299414
complement(668)-g, adbSNP:368087726
complement(670)-t, adbSNP:142656598
complement(688..689)-, cdbSNP:35592174
complement(700)-g, cdbSNP:374591410
complement(769)-g, adbSNP:148886244
complement(779)-t, gdbSNP:146719557
complement(819)-g, adbSNP:370265822
complement(836)-g, cdbSNP:377359516
complement(838)-t, cdbSNP:145563362
complement(862)-t, cdbSNP:192630966
complement(873)-t, cdbSNP:201183342
complement(883)-g, adbSNP:71605213
complement(885)-g, adbSNP:141701497
complement(897)-t, cdbSNP:376267644
complement(928)-g, adbSNP:189096541
complement(962)-g, cdbSNP:200203992
complement(992)-t, cdbSNP:371236168
complement(1002)-g, adbSNP:117761234
1049+a, gdbSNP:6050
complement(1068)-t, cdbSNP:145956993
1097+c, tdbSNP:121909615
complement(1113)-g, adbSNP:373154873
complement(1120)-g, adbSNP:200459889
1129+c, tdbSNP:6051
complement(1130)-t, cdbSNP:201105899
complement(1135)-g, cdbSNP:369650423
complement(1142)-g, adbSNP:201382224
complement(1160)-t, cdbSNP:139005577
complement(1207..1208)-, cdbSNP:35633886
1234+a, tdbSNP:10921
complement(1242)-g, adbSNP:150696254
complement(1246)-c, adbSNP:373276670
complement(1257)-g, adbSNP:184635235
complement(1271)-g, cdbSNP:376065633
complement(1279)-g, adbSNP:202063639
complement(1303)-t, cdbSNP:192689898
complement(1304)-t, cdbSNP:374710954
complement(1336)-t, cdbSNP:141997057
complement(1347)-g, cdbSNP:200607781
complement(1357)-t, cdbSNP:373577582
1394+a, gdbSNP:6052
complement(1394)-g, adbSNP:386601277
complement(1397)-g, cdbSNP:138496061
complement(1408)-g, adbSNP:369849217
1416+a, gdbSNP:121909610
complement(1424)-t, cdbSNP:386556284
complement(1424)-g, adbSNP:2070031
complement(1425)-g, adbSNP:376629642
complement(1429)-t, cdbSNP:143170281
complement(1475)-t, cdbSNP:200378626
1496+a, tdbSNP:121909611
complement(1502)-t, cdbSNP:139146037
complement(1541)-t, cdbSNP:200660625
1577+a, gdbSNP:11553775
complement(1587)-t, cdbSNP:138137585
1600+c, tdbSNP:4766
complement(1607)-t, cdbSNP:140392236
complement(1608)-t, gdbSNP:374854028
complement(1670)-t, cdbSNP:370135141
complement(1691)-t, cdbSNP:146737896
1692+a, tdbSNP:121909612
complement(1702)-g, adbSNP:368704885
complement(1727)-t, gdbSNP:187021713
1775+c, tdbSNP:121909613
1776+a, g, tdbSNP:78506343
complement(1876)-t, cdbSNP:375428976
complement(1879)-g, adbSNP:75588936
complement(1881)-g, cdbSNP:370873387
complement(1896)-t, cdbSNP:201686865
complement(1909)-g, adbSNP:377303847
complement(1951)-dbSNP:
complement(1951)-g, adbSNP:376633833
complement(1957)-c, adbSNP:200882978
complement(2019)-t, cdbSNP:140959479
complement(2028)-t, gdbSNP:146459941
complement(2038)-c, adbSNP:375829433
complement(2047)-g, adbSNP:142544370
complement(2076)-g, adbSNP:372547759
complement(2105)-g, adbSNP:34985782
complement(2109)-t, g, cdbSNP:185920746
complement(2161)-g, adbSNP:148411201
complement(2207)-g, cdbSNP:373841420
complement(2243)-g, cdbSNP:61731299
complement(2244)-t, gdbSNP:369692720
complement(2284)-t, gdbSNP:376434823
complement(2285)-g, adbSNP:201769249
complement(2286)-t, cdbSNP:372219583
complement(2302)-g, adbSNP:368008640
complement(2310)-t, gdbSNP:376739537
complement(2331)-t, cdbSNP:371718702
complement(2343)-g, adbSNP:150073296
complement(2344)-t, cdbSNP:190999281
complement(2369)-t, cdbSNP:367614797
complement(2408)-t, gdbSNP:148824832
complement(2424)-t, cdbSNP:374692754
complement(2461)-t, cdbSNP:200427267
complement(2555)-t, adbSNP:371456244
complement(2568)-g, adbSNP:373925601
complement(2586)-t, cdbSNP:140202402
complement(2628)-c, adbSNP:376940583
complement(2630)-t, cdbSNP:200937785
complement(2644)-t, cdbSNP:2070033
complement(2665..2666)-, gaagacagagtgctcccattcccacttcdbSNP:148317511
complement(2694..2702)-, tctagcaaadbSNP:200176832
complement(2694)-c, adbSNP:199768069
complement(2695)-t, adbSNP:201708558
complement(2704)-t, gdbSNP:145386162
complement(2847)-t, adbSNP:185743436
complement(2853)-t, adbSNP:145679833
complement(2985)-g, adbSNP:181501020
2987+c, tdbSNP:2070022
complement(3155)-t, cdbSNP:189163227
complement(3157)-g, adbSNP:186214551
complement(3159)-c, adbSNP:370233196
complement(3262)-g, adbSNP:182043987
complement(3265)-t, adbSNP:190811888
complement(3279)-g, adbSNP:184098550
complement(3426)-t, cdbSNP:192724024
complement(3441)-t, cdbSNP:2070034
complement(3471)-g, adbSNP:188401981
complement(3484)-g, adbSNP:367551249
Gene SymbolFGA
Gene SynonymFib2
Chromosome4
Locus Map4q28
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_021871 Homo sapiens fibrinogen alpha chain (FGA), transcript variant alpha, mRNA. On-demand TBD TBD
NM_000508 Homo sapiens fibrinogen alpha chain (FGA), transcript variant alpha-E, mRNA. On-demand TBD TBD
Title Dermatopontin regulates fibrin formation and its biological activity .
Author Wu W, Okamoto O, Kato A, Matsuo N, Nomizu M, Yoshioka H and Fujiwara S.
Journal J. Invest. Dermatol. 134 (1), 256-263 (2014)
Title Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease .
Author Sabater-Lleal M, Huang J, Chasman D, Naitza S, Dehghan A, Johnson AD, Teumer A, Reiner AP, Folkersen L, Basu S, Rudnicka AR, Trompet S, Malarstig A, Baumert J, Bis JC, Guo X, Hottenga JJ, Shin SY, Lopez LM, Lahti J, Tanaka T, Yanek LR, Oudot-Mellakh T, Wilson JF, Navarro P, Huffman JE, Zemunik T, Redline S, Mehra R, Pulanic D, Rudan I, Wright AF, Kolcic I, Polasek O, Wild SH, Campbell H, Curb JD, Wallace R, Liu S, Eaton CB, Becker DM, Becker LC, Bandinelli S, Raikkonen K, Widen E, Palotie A, Fornage M, Green D, Gross M, Davies G, Harris SE, Liewald DC, Starr JM, Williams FM, Grant PJ, Spector TD, Strawbridge RJ, Silveira A, Sennblad B, Rivadeneira F, Uitterlinden AG, Franco OH, Hofman A, van Dongen J, Willemsen G, Boomsma DI, Yao J, Swords Jenny N, Haritunians T, McKnight B, Lumley T, Taylor KD, Rotter JI, Psaty BM, Peters A, Gieger C, Illig T, Grotevendt A, Homuth G, Volzke H, Kocher T, Goel A, Franzosi MG, Seedorf U, Clarke R, Steri M, Tarasov KV, Sanna S, Schlessinger D, Stott DJ, Sattar N, Buckley BM, Rumley A, Lowe GD, McArdle WL, Chen MH, Tofler GH, Song J, Boerwinkle E, Folsom AR, Rose LM, Franco-Cereceda A, Teichert M, Ikram MA, Mosley TH, Bevan S, Dichgans M, Rothwell PM, Sudlow CL, Hopewell JC, Chambers JC, Saleheen D, Kooner JS, Danesh J, Nelson CP, Erdmann J, Reilly MP, Kathiresan S, Schunkert H, Morange PE, Ferrucci L, Eriksson JG, Jacobs D, Deary IJ, Soranzo N, Witteman JC, de Geus EJ, Tracy RP, Hayward C, Koenig W, Cucca F, Jukema JW, Eriksson P, Seshadri S, Markus HS, Watkins H, Samani NJ, Wallaschofski H, Smith NL, Tregouet D, Ridker PM, Tang W, Strachan DP, Hamsten A and O'Donnell CJ.
Journal Circulation 128 (12), 1310-1324 (2013)
Title A study on human serum albumin influence on glycation of fibrinogen .
Author Kielmas M, Szewczuk Z and Stefanowicz P.
Journal Biochem. Biophys. Res. Commun. 439 (1), 78-83 (2013)
Title Congenital fibrinogen disorders: an update .
Author de Moerloose P, Casini A and Neerman-Arbez M.
Journal Semin. Thromb. Hemost. 39 (6), 585-595 (2013)
Title Fibrinogen Aalpha Thr312Ala polymorphism specifically contributes to chronic thromboembolic pulmonary hypertension by increasing fibrin resistance .
Author Li JF, Lin Y, Yang YH, Gan HL, Liang Y, Liu J, Yang SQ, Zhang WJ, Cui N, Zhao L, Zhai ZG, Wang J and Wang C.
Journal PLoS ONE 8 (7), E69635 (2013)
Title Fibrinogen Marburg: a homozygous case of dysfibrinogenemia, lacking amino acids A alpha 461-610 (Lys 461 AAA-->stop TAA) .
Author Koopman J, Haverkate F, Grimbergen J, Egbring R and Lord ST.
Journal Blood 80 (8), 1972-1979 (1992)
Title Amino acid sequence studies on the alpha chain of human fibrinogen. Overlapping sequences providing the complete sequence .
Author Watt,K.W., Cottrell,B.A., Strong,D.D. and Doolittle,R.F.
Journal Biochemistry 18 (24), 5410-5416 (1979)
Title Amino acid sequence studies on the alpha chain of human fibrinogen. Exact location of cross-linking acceptor sites .
Author Cottrell,B.A., Strong,D.D., Watt,K.W. and Doolittle,R.F.
Journal Biochemistry 18 (24), 5405-5410 (1979)
Title Localization of the alpha-chain cross-link acceptor sites of human fibrin .
Author Fretto,L.J., Ferguson,E.W., Steinman,H.M. and McKee,P.A.
Journal J. Biol. Chem. 253 (7), 2184-2195 (1978)
Title Disulfide bridges in nh2 -terminal part of human fibrinogen .
Author Blomback,B., Hessel,B. and Hogg,D.
Journal Thromb. Res. 8 (5), 639-658 (1976)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.