• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibrinogen alpha chain (FGA), transcript variant alpha-E, mRNA.


RefSeq Accession Definition Services Price Order
NM_000508 Homo sapiens fibrinogen alpha chain (FGA), transcript variant alpha-E, mRNA. ORF Sequence $754.29
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000508.3, 70906432
Length 3655 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens fibrinogen alpha chain (FGA), transcript variant alpha-E, mRNA.
Product fibrinogen alpha chain isoform alpha-E preproprotein
Comment

Summary: The protein encoded by this gene is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in two isoforms which vary in the carboxy-terminus. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (alpha-E) represents the longer transcript and encodes the longer isoform (alpha-E).

RefSeq NP_000499.1
CDS 59..2659
Misc Feature(1)122..124
Misc Feature(2)122..124
Misc Feature(3)161..166
Misc Feature(4)164..172
Misc Feature(5)200..616
Misc Feature(6)356..361
Misc Feature(7)419..424
Misc Feature(8)425..430
Misc Feature(9)887..889
Misc Feature(10)1148..1150
Misc Feature(11)1292..1294
Misc Feature(12)order(1439..1441,1529..1531)
Misc Feature(13)<1463..1588
Misc Feature(14)1829..1831
Misc Feature(15)1883..1885
Misc Feature(16)1937..2647
Misc Feature(17)2312..2314
Misc Feature(18)order(2429..2431,2435..2437,2441..2443)
Misc Feature(19)order(2453..2455,2462..2467,2492..2497)
Exon (1)1..112
Gene:FGA
Gene Synonym:Fib2
Exon (2)113..238
Gene:FGA
Gene Synonym:Fib2
Exon (3)239..422
Gene:FGA
Gene Synonym:Fib2
Exon (4)423..568
Gene:FGA
Gene Synonym:Fib2
Exon (5)569..1949
Gene:FGA
Gene Synonym:Fib2
Exon (6)1950..3655
Gene:FGA
Gene Synonym:Fib2
Translation MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDW NYKCPSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSA NNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSC RGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIKMKPVPDLVPGNFKSQ LQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSS GPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTW NPGSSERGSAGHWTSESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNV SPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTK EVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEF VSETESRGSESGIFTNTKESSSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKS YKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFS VYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQR GSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSH NNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENG VVWVSFRGADYSLRAVRMKIRPLVTQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(1)-dbSNP:
complement(1)-g, adbSNP:2070011
complement(37)-t, cdbSNP:149887756
complement(74)-g, adbSNP:2070025
complement(77)-t, cdbSNP:184672247
complement(134)-dbSNP:
complement(134)-g, adbSNP:121909604
complement(150)-t, gdbSNP:121909605
complement(161)-t, cdbSNP:121909606
complement(162)-g, adbSNP:121909607
complement(168)-t, cdbSNP:121909609
complement(170)-g, adbSNP:121909608
complement(174)-t, adbSNP:121909614
complement(211)-g, adbSNP:143369046
complement(262)-dbSNP:
complement(262)-g, adbSNP:111594488
complement(302)-t, gdbSNP:199554805
complement(306)-t, cdbSNP:186283932
complement(321)-t, adbSNP:77531839
complement(322)-g, adbSNP:200812094
complement(358)-t, cdbSNP:112877216
complement(370)-t, cdbSNP:201709083
complement(371)-g, adbSNP:147070445
complement(403)-g, adbSNP:141623466
complement(461)-dbSNP:
complement(461)-t, cdbSNP:147888314
complement(533)-t, cdbSNP:199828049
complement(590)-dbSNP:
complement(590)-g, adbSNP:140911890
complement(599)-g, adbSNP:199717989
complement(603)-g, cdbSNP:151016432
complement(665)-g, adbSNP:200299414
complement(670)-t, adbSNP:142656598
complement(688..689)-, cdbSNP:35592174
complement(769)-g, adbSNP:148886244
complement(779)-t, gdbSNP:146719557
complement(838)-t, cdbSNP:145563362
complement(862)-t, cdbSNP:192630966
complement(873)-t, cdbSNP:201183342
complement(883)-g, adbSNP:71605213
complement(885)-g, adbSNP:141701497
complement(928)-g, adbSNP:189096541
complement(962)-g, cdbSNP:200203992
complement(1002)-g, adbSNP:117761234
complement(1049)-g, adbSNP:6050
complement(1068)-t, cdbSNP:145956993
complement(1097)-t, cdbSNP:121909615
complement(1120)-g, adbSNP:200459889
complement(1129)-t, cdbSNP:6051
complement(1130)-t, cdbSNP:201105899
complement(1142)-g, adbSNP:201382224
complement(1160)-t, cdbSNP:139005577
complement(1208..1209)-, cdbSNP:35633886
complement(1234)-t, adbSNP:10921
complement(1242)-g, adbSNP:150696254
complement(1257)-g, adbSNP:184635235
complement(1279)-g, adbSNP:202063639
complement(1303)-t, cdbSNP:192689898
complement(1336)-t, cdbSNP:141997057
complement(1347)-g, cdbSNP:200607781
complement(1394)-g, adbSNP:6052
complement(1397)-g, cdbSNP:138496061
complement(1416)-g, adbSNP:121909610
complement(1424)-g, adbSNP:2070031
complement(1429)-t, cdbSNP:143170281
complement(1475)-t, cdbSNP:200378626
complement(1496)-t, adbSNP:121909611
complement(1502)-t, cdbSNP:139146037
complement(1521)-t, cdbSNP:146501995
complement(1528)-g, cdbSNP:149142775
complement(1541)-t, cdbSNP:200660625
complement(1577)-g, adbSNP:11553775
complement(1587)-t, cdbSNP:138137585
complement(1600)-t, cdbSNP:4766
complement(1607)-t, cdbSNP:140392236
complement(1691)-t, cdbSNP:146737896
complement(1692)-t, adbSNP:121909612
complement(1727)-t, gdbSNP:187021713
complement(1775)-t, cdbSNP:121909613
complement(1776)-t, g, adbSNP:78506343
complement(1879)-g, adbSNP:75588936
complement(1896)-t, cdbSNP:201686865
complement(1957)-dbSNP:
complement(1957)-c, adbSNP:200882978
complement(2019)-t, cdbSNP:140959479
complement(2028)-t, gdbSNP:146459941
complement(2047)-g, adbSNP:142544370
complement(2105)-g, adbSNP:34985782
complement(2109)-t, gdbSNP:185920746
complement(2161)-g, adbSNP:148411201
complement(2243)-g, cdbSNP:61731299
complement(2285)-g, adbSNP:201769249
complement(2343)-g, adbSNP:150073296
complement(2344)-t, cdbSNP:190999281
complement(2408)-t, gdbSNP:148824832
complement(2461)-t, cdbSNP:200427267
complement(2586)-t, cdbSNP:140202402
complement(2630)-t, cdbSNP:200937785
complement(2644)-t, cdbSNP:2070033
complement(2692..2693)-, gaagacagagtgctcccattcccacttcdbSNP:35496957
complement(2693..2694)-, gaagacagagtgctcccattcccacttcdbSNP:148317511
complement(2694..2702)-, tctagcaaadbSNP:200176832
complement(2694)-c, adbSNP:199768069
complement(2695)-t, adbSNP:201708558
complement(2704)-t, gdbSNP:145386162
complement(2847)-t, adbSNP:185743436
complement(2853)-t, adbSNP:145679833
complement(2985)-g, adbSNP:181501020
complement(2987)-t, cdbSNP:2070022
complement(3155)-t, cdbSNP:189163227
complement(3157)-g, adbSNP:186214551
complement(3262)-g, adbSNP:182043987
complement(3265)-t, adbSNP:190811888
complement(3279)-g, adbSNP:184098550
complement(3426)-t, cdbSNP:192724024
complement(3441)-t, cdbSNP:2070034
complement(3471)-g, adbSNP:188401981
Gene SymbolFGA
Gene SynonymFib2
Chromosome4
Locus Map4q28
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000508 Homo sapiens fibrinogen alpha chain (FGA), transcript variant alpha-E, mRNA. Full Length $1279.25
ORF Sequence $754.29
NM_021871 Homo sapiens fibrinogen alpha chain (FGA), transcript variant alpha, mRNA. Full Length $640.90
ORF Sequence $561.15
Title Clinical phenotype, laboratory features and genotype of 35 patients with heritable dysfibrinogenaemia .
Author Shapiro,S.E., Phillips,E., Manning,R.A., Morse,C.V., Murden,S.L., Laffan,M.A. and Mumford,A.D.
Journal Br. J. Haematol. 160 (2), 220-227 (2013)
Title Fibrinogen gene regulation .
Author Fish,R.J. and Neerman-Arbez,M.
Journal Thromb. Haemost. 108 (3), 419-426 (2012)
Title Fibrinogen excretion in the urine and immunoreactivity in the kidney serves as a translational biomarker for acute kidney injury .
Author Hoffmann,D., Bijol,V., Krishnamoorthy,A., Gonzalez,V.R., Frendl,G., Zhang,Q., Goering,P.L., Brown,R.P., Waikar,S.S. and Vaidya,V.S.
Journal Am. J. Pathol. 181 (3), 818-828 (2012)
Title Fibrinogen Gdansk: hypofibrinogenemia associated with a novel missense mutation in FGA (Ser112Pro) .
Author Mital,A., Undas,A., Neerman-Arbez,M. and Hellmann,A.
Journal Thromb. Res. 130 (3), E196-E197 (2012)
Title PDGF suppresses the sulfation of CD44v and potentiates CD44v-mediated binding of colon carcinoma cells to fibrin under flow .
Author Alves,C.S. and Konstantopoulos,K.
Journal PLoS ONE 7 (10), E41472 (2012)
Title Fibrinogen Marburg: a homozygous case of dysfibrinogenemia, lacking amino acids A alpha 461-610 (Lys 461 AAA-->stop TAA) .
Author Koopman,J., Haverkate,F., Grimbergen,J., Egbring,R. and Lord,S.T.
Journal Blood 80 (8), 1972-1979 (1992)
Title Amino acid sequence studies on the alpha chain of human fibrinogen. Overlapping sequences providing the complete sequence .
Author Watt,K.W., Cottrell,B.A., Strong,D.D. and Doolittle,R.F.
Journal Biochemistry 18 (24), 5410-5416 (1979)
Title Amino acid sequence studies on the alpha chain of human fibrinogen. Exact location of cross-linking acceptor sites .
Author Cottrell,B.A., Strong,D.D., Watt,K.W. and Doolittle,R.F.
Journal Biochemistry 18 (24), 5405-5410 (1979)
Title Localization of the alpha-chain cross-link acceptor sites of human fibrin .
Author Fretto,L.J., Ferguson,E.W., Steinman,H.M. and McKee,P.A.
Journal J. Biol. Chem. 253 (7), 2184-2195 (1978)
Title Disulfide bridges in nh2 -terminal part of human fibrinogen .
Author Blomback,B., Hessel,B. and Hogg,D.
Journal Thromb. Res. 8 (5), 639-658 (1976)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878