• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibrinogen gamma chain (FGG), transcript variant gamma-A, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000509 Homo sapiens fibrinogen gamma chain (FGG), transcript variant gamma-A, mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_000509.4, 70906436
Length 1665 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens fibrinogen gamma chain (FGG), transcript variant gamma-A, mRNA.
Product fibrinogen gamma chain isoform gamma-A precursor
Comment

Summary: The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (gamma-A) is the predominant transcript and is shorter than variant gamma-B. Variant gamma-A encodes isoform gamma-A, which is shorter and has a distinct C-terminus compared to isoform gamma-B.

RefSeq NP_000500.2
CDS 142..1455
Misc Feature(1)103..105
Misc Feature(2)103..105
Misc Feature(3)226..660
Misc Feature(4)373..375
Misc Feature(5)391..396
Misc Feature(6)403..408
Misc Feature(7)445..450
Misc Feature(8)661..1386
Misc Feature(9)1042..1044
Misc Feature(10)order(1171..1173,1177..1179,1183..1185)
Misc Feature(11)order(1195..1197,1204..1209,1234..1239)
Misc Feature(12)1339..1407
Exon (1)1..219
Gene:FGG
Gene Synonym:FGG
Exon (2)220..264
Gene:FGG
Gene Synonym:FGG
Exon (3)265..448
Gene:FGG
Gene Synonym:FGG
Exon (4)449..542
Gene:FGG
Gene Synonym:FGG
Exon (5)543..673
Gene:FGG
Gene Synonym:FGG
Exon (6)674..807
Gene:FGG
Gene Synonym:FGG
Exon (7)808..992
Gene:FGG
Gene Synonym:FGG
Exon (8)993..1270
Gene:FGG
Gene Synonym:FGG
Exon (9)1271..1440
Gene:FGG
Gene Synonym:FGG
Exon (10)1441..1661
Gene:FGG
Gene Synonym:FGG
Translation MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQT KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIM KYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQ DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEG FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKY RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW WMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI GEGQQHHLGGAKQAGDV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(128)-g, adbSNP:11551851
complement(147)-t, adbSNP:201346883
complement(156)-g, adbSNP:11551843
complement(157)-g, adbSNP:202138176
complement(176)-t, cdbSNP:11551852
complement(178)-g, adbSNP:200241886
complement(183)-c, adbSNP:11551842
complement(186)-t, cdbSNP:11551841
complement(204)-t, cdbSNP:11551848
complement(215)-g, adbSNP:62637584
complement(216)-g, adbSNP:11551839
complement(258)-dbSNP:
complement(258)-g, adbSNP:11551844
complement(264)-g, adbSNP:141554929
complement(265)-dbSNP:
complement(265)-t, cdbSNP:202132393
complement(281)-g, adbSNP:138511699
complement(297)-g, adbSNP:11551836
complement(301)-t, cdbSNP:11551840
complement(330)-g, cdbSNP:145914446
complement(354)-g, adbSNP:142224295
complement(371)-g, adbSNP:11551835
complement(402)-g, adbSNP:11551850
complement(407)-t, cdbSNP:11551849
complement(415)-g, adbSNP:142286849
complement(450)-dbSNP:
complement(450)-g, adbSNP:138916334
complement(459)-g, adbSNP:150242757
complement(464)-g, cdbSNP:148685782
complement(478)-g, adbSNP:12739
complement(482)-t, adbSNP:1894263
complement(515)-g, adbSNP:200696007
complement(516)-t, cdbSNP:199584269
complement(535)-t, gdbSNP:76077503
complement(536)-g, adbSNP:11551837
complement(559)-dbSNP:
complement(559)-t, cdbSNP:2066870
complement(643)-t, cdbSNP:141559764
complement(651)-t, cdbSNP:147871795
complement(699)-t, cdbSNP:200552748
complement(712)-g, adbSNP:6063
complement(715..716)-t, cdbSNP:11551846
complement(738..739)-g, adbSNP:11551838
complement(770)-c, adbSNP:188272310
complement(771)-t, gdbSNP:148688900
complement(797)-c, adbSNP:36102237
complement(875)-dbSNP:
complement(875)-g, adbSNP:145051028
complement(951)-g, adbSNP:149932421
complement(1042)-dbSNP:
complement(1042)-t, cdbSNP:121913087
complement(1043)-g, adbSNP:121913088
complement(1063)-t, cdbSNP:139133145
complement(1067)-g, adbSNP:121913096
1093+c, gdbSNP:267606810
complement(1094)-t, gdbSNP:121913089
complement(1107)-g, adbSNP:146218442
complement(1142)-t, adbSNP:121913090
complement(1148)-t, cdbSNP:121913091
complement(1205)-g, adbSNP:121913092
complement(1207)-t, gdbSNP:121913093
complement(1208)-t, adbSNP:121913094
complement(1240)-t, cdbSNP:78257946
complement(1270)-c, adbSNP:192482410
complement(1309)-dbSNP:
complement(1309)-g, cdbSNP:121913095
complement(1320)-c, adbSNP:199520597
complement(1342)-t, g, cdbSNP:75848804
complement(1369)-g, adbSNP:6061
complement(1373)-t, gdbSNP:200444079
complement(1379)-g, adbSNP:201018513
complement(1423)-, gdbSNP:35443439
complement(1426)-c, adbSNP:145938787
complement(1432)-t, cdbSNP:187841130
complement(1449)-g, adbSNP:191297318
complement(1457)-t, gdbSNP:187316301
complement(1461)-g, adbSNP:183036893
complement(1462)-t, cdbSNP:201803385
complement(1496)-t, cdbSNP:146143405
complement(1535)-g, adbSNP:75785972
complement(1574)-g, adbSNP:143080842
complement(1601)-g, adbSNP:138492308
Gene SymbolFGG
Gene SynonymFGG
Chromosome4
Locus Map4q28
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000509 Homo sapiens fibrinogen gamma chain (FGG), transcript variant gamma-A, mRNA. In-stock $509.00 $460.00 12
NM_021870 Homo sapiens fibrinogen gamma chain (FGG), transcript variant gamma-B, mRNA. On-demand $699.00 18
Title Clinical phenotype, laboratory features and genotype of 35 patients with heritable dysfibrinogenaemia .
Author Shapiro,S.E., Phillips,E., Manning,R.A., Morse,C.V., Murden,S.L., Laffan,M.A. and Mumford,A.D.
Journal Br. J. Haematol. 160 (2), 220-227 (2013)
Title Fibrinogen gene regulation .
Author Fish,R.J. and Neerman-Arbez,M.
Journal Thromb. Haemost. 108 (3), 419-426 (2012)
Title Fibrinogen Melbourne: a novel congenital hypodysfibrinogenemia caused by gamma326Cys-Phe in the fibrinogen gamma chain, presenting as massive splanchnic venous thrombosis .
Author Cheah,C.Y., Brennan,S.O., Kennedy,H., Januszewicz,E.H., Maxwell,E. and Burbury,K.
Journal Blood Coagul. Fibrinolysis 23 (6), 563-565 (2012)
Title Fibrinogen, COPD and mortality in a nationally representative U.S. cohort .
Author Mannino,D.M., Valvi,D., Mullerova,H. and Tal-Singer,R.
Journal COPD 9 (4), 359-366 (2012)
Title PDGF suppresses the sulfation of CD44v and potentiates CD44v-mediated binding of colon carcinoma cells to fibrin under flow .
Author Alves,C.S. and Konstantopoulos,K.
Journal PLoS ONE 7 (10), E41472 (2012)
Title Assembly and secretion of fibrinogen. Degradation of individual chains .
Author Roy,S., Yu,S., Banerjee,D., Overton,O., Mukhopadhyay,G., Oddoux,C., Grieninger,G. and Redman,C.
Journal J. Biol. Chem. 267 (32), 23151-23158 (1992)
Title Heterozygous abnormal fibrinogen Osaka III with the replacement of gamma arginine-275 by histidine has an apparently higher molecular weight gamma-chain variant .
Author Yoshida,N., Imaoka,S., Hirata,H., Matsuda,M. and Asakura,S.
Journal Thromb. Haemost. 68 (5), 534-538 (1992)
Title Gene analyses of abnormal fibrinogens with a mutation in the gamma chain .
Author Mimuro,J., Muramatsu,S., Maekawa,H., Sakata,Y., Kaneko,M., Yoshitake,S., Okuma,M., Ito,Y., Takeda,Y. and Matsuda,M.
Journal Int. J. Hematol. 56 (2), 129-134 (1992)
Title Polymorphism of the human gamma chain fibrinogen gene .
Author Marchetti,L., Zanelli,T., Malcovati,M. and Tenchini,M.L.
Journal DNA Seq. 1 (6), 419-422 (1991)
Title Disulfide bridges in nh2 -terminal part of human fibrinogen .
Author Blomback,B., Hessel,B. and Hogg,D.
Journal Thromb. Res. 8 (5), 639-658 (1976)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.