• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibrinogen gamma chain (FGG), transcript variant gamma-A, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000509 Homo sapiens fibrinogen gamma chain (FGG), transcript variant gamma-A, mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_000509.4, 70906436
Length 1665 bp
Structure linear
Update Date 24-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens fibrinogen gamma chain (FGG), transcript variant gamma-A, mRNA.
Product fibrinogen gamma chain isoform gamma-A precursor
Comment

Summary: The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (gamma-A) is the predominant transcript and is shorter than variant gamma-B. Variant gamma-A encodes isoform gamma-A, which is shorter and has a distinct C-terminus compared to isoform gamma-B.

RefSeq NP_000500.2
CDS 142..1455
Misc Feature(1)103..105
Misc Feature(2)103..105
Misc Feature(3)226..660
Misc Feature(4)373..375
Misc Feature(5)391..396
Misc Feature(6)403..408
Misc Feature(7)445..450
Misc Feature(8)661..1386
Misc Feature(9)1042..1044
Misc Feature(10)order(1171..1173,1177..1179,1183..1185)
Misc Feature(11)order(1195..1197,1204..1209,1234..1239)
Misc Feature(12)1339..1407
Exon (1)1..219
Gene:FGG
Gene Synonym:FGG
Exon (2)220..264
Gene:FGG
Gene Synonym:FGG
Exon (3)265..448
Gene:FGG
Gene Synonym:FGG
Exon (4)449..542
Gene:FGG
Gene Synonym:FGG
Exon (5)543..673
Gene:FGG
Gene Synonym:FGG
Exon (6)674..807
Gene:FGG
Gene Synonym:FGG
Exon (7)808..992
Gene:FGG
Gene Synonym:FGG
Exon (8)993..1270
Gene:FGG
Gene Synonym:FGG
Exon (9)1271..1440
Gene:FGG
Gene Synonym:FGG
Exon (10)1441..1661
Gene:FGG
Gene Synonym:FGG
Translation MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQT KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIM KYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQ DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEG FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKY RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW WMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI GEGQQHHLGGAKQAGDV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(127)-t, cdbSNP:376225478
128+a, gdbSNP:11551851
complement(139)-t, cdbSNP:372005973
complement(145)-t, gdbSNP:367824435
complement(147)-t, adbSNP:201346883
156+a, gdbSNP:11551843
complement(157)-g, adbSNP:202138176
complement(160)-g, adbSNP:374845868
176+c, tdbSNP:11551852
complement(178)-g, adbSNP:200241886
183+a, cdbSNP:11551842
186+c, tdbSNP:11551841
204+c, tdbSNP:11551848
complement(215)-g, adbSNP:62637584
216+a, gdbSNP:11551839
258+dbSNP:
258+a, gdbSNP:11551844
complement(264)-g, adbSNP:141554929
complement(265)-dbSNP:
complement(265)-t, cdbSNP:202132393
complement(281)-g, adbSNP:138511699
297+a, gdbSNP:11551836
301+c, tdbSNP:11551840
complement(330)-g, cdbSNP:145914446
complement(337)-g, adbSNP:376769607
complement(354)-g, adbSNP:142224295
371+a, gdbSNP:11551835
402+a, gdbSNP:11551850
407+c, tdbSNP:11551849
complement(415)-g, adbSNP:142286849
complement(417)-t, gdbSNP:369888820
complement(450)-dbSNP:
complement(450)-g, adbSNP:138916334
complement(459)-g, adbSNP:150242757
complement(464)-g, cdbSNP:148685782
478+a, gdbSNP:12739
482+a, tdbSNP:1894263
complement(515)-g, adbSNP:200696007
complement(516)-t, cdbSNP:199584269
complement(535)-t, gdbSNP:76077503
536+a, gdbSNP:11551837
complement(559)-dbSNP:
complement(559)-t, cdbSNP:2066870
complement(559)-g, adbSNP:386556133
complement(601)-c, adbSNP:376729836
complement(643)-t, cdbSNP:141559764
complement(644)-g, adbSNP:371692602
complement(651)-t, cdbSNP:147871795
complement(699)-t, cdbSNP:200552748
complement(700)-t, cdbSNP:371057137
complement(704)-t, cdbSNP:368665533
complement(712)-g, adbSNP:386455320
715..716+c, tdbSNP:11551846
738..739+a, gdbSNP:11551838
complement(770)-c, adbSNP:188272310
complement(771)-t, gdbSNP:148688900
complement(797)-c, adbSNP:36102237
complement(821)-dbSNP:
complement(821)-t, cdbSNP:372737021
complement(875)-g, adbSNP:145051028
complement(888)-t, adbSNP:370475378
complement(920)-t, cdbSNP:376120251
complement(936)-c, adbSNP:374053381
complement(951)-g, adbSNP:149932421
complement(1022)-dbSNP:
complement(1022)-g, cdbSNP:377163164
1042+c, tdbSNP:121913087
1043+a, gdbSNP:121913088
complement(1063)-t, cdbSNP:139133145
1067+a, gdbSNP:121913096
1093+c, gdbSNP:267606810
1094+g, tdbSNP:121913089
complement(1107)-g, adbSNP:146218442
1142+a, tdbSNP:121913090
1148+c, tdbSNP:121913091
1205+a, gdbSNP:121913092
1207+g, tdbSNP:121913093
1208+a, tdbSNP:121913094
complement(1239)-g, adbSNP:374166238
complement(1240)-t, cdbSNP:78257946
complement(1270)-c, adbSNP:192482410
complement(1271)-dbSNP:
complement(1271)-c, adbSNP:369271819
1309+c, gdbSNP:121913095
complement(1320)-c, adbSNP:199520597
1342+c, g, tdbSNP:75848804
1369+a, gdbSNP:6061
complement(1373)-t, gdbSNP:200444079
complement(1379)-g, adbSNP:201018513
complement(1399)-t, cdbSNP:374917187
complement(1422)-, gdbSNP:35443439
complement(1426)-c, adbSNP:145938787
complement(1432)-t, cdbSNP:187841130
complement(1441)-dbSNP:
complement(1441)-c, adbSNP:375111958
complement(1449)-g, adbSNP:191297318
complement(1457)-t, gdbSNP:187316301
complement(1461)-g, adbSNP:183036893
complement(1462)-t, cdbSNP:201803385
complement(1496)-t, cdbSNP:146143405
complement(1535)-g, adbSNP:75785972
1574+a, gdbSNP:143080842
complement(1601)-g, adbSNP:138492308
Gene SymbolFGG
Gene SynonymFGG
Chromosome4
Locus Map4q28
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000509 Homo sapiens fibrinogen gamma chain (FGG), transcript variant gamma-A, mRNA. In-stock $509.00 $460.00 12
NM_021870 Homo sapiens fibrinogen gamma chain (FGG), transcript variant gamma-B, mRNA. On-demand $699.00 18
Title Dermatopontin regulates fibrin formation and its biological activity .
Author Wu W, Okamoto O, Kato A, Matsuo N, Nomizu M, Yoshioka H and Fujiwara S.
Journal J. Invest. Dermatol. 134 (1), 256-263 (2014)
Title Procoagulant platelets form an alpha-granule protein-covered 'cap' on their surface that promotes their attachment to aggregates .
Author Abaeva AA, Canault M, Kotova YN, Obydennyy SI, Yakimenko AO, Podoplelova NA, Kolyadko VN, Chambost H, Mazurov AV, Ataullakhanov FI, Nurden AT, Alessi MC and Panteleev MA.
Journal J. Biol. Chem. 288 (41), 29621-29632 (2013)
Title Zn2+ mediates high affinity binding of heparin to the alphaC domain of fibrinogen .
Author Fredenburgh JC, Leslie BA, Stafford AR, Lim T, Chan HH and Weitz JI.
Journal J. Biol. Chem. 288 (41), 29394-29402 (2013)
Title Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease .
Author Sabater-Lleal M, Huang J, Chasman D, Naitza S, Dehghan A, Johnson AD, Teumer A, Reiner AP, Folkersen L, Basu S, Rudnicka AR, Trompet S, Malarstig A, Baumert J, Bis JC, Guo X, Hottenga JJ, Shin SY, Lopez LM, Lahti J, Tanaka T, Yanek LR, Oudot-Mellakh T, Wilson JF, Navarro P, Huffman JE, Zemunik T, Redline S, Mehra R, Pulanic D, Rudan I, Wright AF, Kolcic I, Polasek O, Wild SH, Campbell H, Curb JD, Wallace R, Liu S, Eaton CB, Becker DM, Becker LC, Bandinelli S, Raikkonen K, Widen E, Palotie A, Fornage M, Green D, Gross M, Davies G, Harris SE, Liewald DC, Starr JM, Williams FM, Grant PJ, Spector TD, Strawbridge RJ, Silveira A, Sennblad B, Rivadeneira F, Uitterlinden AG, Franco OH, Hofman A, van Dongen J, Willemsen G, Boomsma DI, Yao J, Swords Jenny N, Haritunians T, McKnight B, Lumley T, Taylor KD, Rotter JI, Psaty BM, Peters A, Gieger C, Illig T, Grotevendt A, Homuth G, Volzke H, Kocher T, Goel A, Franzosi MG, Seedorf U, Clarke R, Steri M, Tarasov KV, Sanna S, Schlessinger D, Stott DJ, Sattar N, Buckley BM, Rumley A, Lowe GD, McArdle WL, Chen MH, Tofler GH, Song J, Boerwinkle E, Folsom AR, Rose LM, Franco-Cereceda A, Teichert M, Ikram MA, Mosley TH, Bevan S, Dichgans M, Rothwell PM, Sudlow CL, Hopewell JC, Chambers JC, Saleheen D, Kooner JS, Danesh J, Nelson CP, Erdmann J, Reilly MP, Kathiresan S, Schunkert H, Morange PE, Ferrucci L, Eriksson JG, Jacobs D, Deary IJ, Soranzo N, Witteman JC, de Geus EJ, Tracy RP, Hayward C, Koenig W, Cucca F, Jukema JW, Eriksson P, Seshadri S, Markus HS, Watkins H, Samani NJ, Wallaschofski H, Smith NL, Tregouet D, Ridker PM, Tang W, Strachan DP, Hamsten A and O'Donnell CJ.
Journal Circulation 128 (12), 1310-1324 (2013)
Title Stepwise assembly of fibrinogen is assisted by the endoplasmic reticulum lectin-chaperone system in HepG2 cells .
Author Tamura T, Arai S, Nagaya H, Mizuguchi J and Wada I.
Journal PLoS ONE 8 (9), E74580 (2013)
Title Assembly and secretion of fibrinogen. Degradation of individual chains .
Author Roy S, Yu S, Banerjee D, Overton O, Mukhopadhyay G, Oddoux C, Grieninger G and Redman C.
Journal J. Biol. Chem. 267 (32), 23151-23158 (1992)
Title Heterozygous abnormal fibrinogen Osaka III with the replacement of gamma arginine-275 by histidine has an apparently higher molecular weight gamma-chain variant .
Author Yoshida N, Imaoka S, Hirata H, Matsuda M and Asakura S.
Journal Thromb. Haemost. 68 (5), 534-538 (1992)
Title Gene analyses of abnormal fibrinogens with a mutation in the gamma chain .
Author Mimuro J, Muramatsu S, Maekawa H, Sakata Y, Kaneko M, Yoshitake S, Okuma M, Ito Y, Takeda Y and Matsuda M.
Journal Int. J. Hematol. 56 (2), 129-134 (1992)
Title Polymorphism of the human gamma chain fibrinogen gene .
Author Marchetti L, Zanelli T, Malcovati M and Tenchini ML.
Journal DNA Seq. 1 (6), 419-422 (1991)
Title Disulfide bridges in nh2 -terminal part of human fibrinogen .
Author Blomback,B., Hessel,B. and Hogg,D.
Journal Thromb. Res. 8 (5), 639-658 (1976)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.