• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens von Willebrand factor (VWF), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000552 Homo sapiens von Willebrand factor (VWF), mRNA. GenEZ ORF Cloning In-stock $2448.00 $2399.00 24

*Business Day

Related Services

RefSeq Version NM_000552.3, 89191867
Length 8833 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens von Willebrand factor (VWF), mRNA.
Product von Willebrand factor preproprotein
Comment

Summary: The glycoprotein encoded by this gene functions as both an antihemophilic factor carrier and a platelet-vessel wall mediator in the blood coagulation system. It is crucial to the hemostasis process. Mutations in this gene or deficiencies in this protein result in von Willebrand's disease. An unprocessed pseudogene has been found on chromosome 22. [provided by RefSeq, Jul 2008].

RefSeq NP_000543.2
CDS 251..8692
Misc Feature(1)170..172
Misc Feature(2)347..784
Misc Feature(3)914..1123
Misc Feature(4)1133..1294
Misc Feature(5)1298..>1432
Misc Feature(6)1379..1870
Misc Feature(7)1979..2197
Misc Feature(8)2204..2371
Misc Feature(9)2540..2611
Misc Feature(10)order(2549..2551,2672..2674)
Misc Feature(11)order(2576..2578,2660..2662)
Misc Feature(12)2612..2749
Misc Feature(13)order(2678..2680,2711..2713)
Misc Feature(14)2726..2809
Misc Feature(15)2816..3283
Misc Feature(16)order(2849..2851,3236..3238)
Misc Feature(17)order(2915..2917,3341..3343)
Misc Feature(18)order(2942..2944,3227..3229)
Misc Feature(19)order(2990..2992,3011..3013)
Misc Feature(20)3407..3631
Misc Feature(21)order(3428..3430,3500..3502)
Misc Feature(22)order(3626..3628,3638..3640)
Misc Feature(23)3686..3838
Misc Feature(24)order(3695..3697,3755..3757)
Misc Feature(25)order(3707..3709,3743..3745)
Misc Feature(26)order(3836..3838,3845..3847)
Misc Feature(27)order(4064..4066,4622..4624)
Misc Feature(28)4076..4564
Misc Feature(29)order(4076..4078,4082..4084,4145..4147,4388..4390,
Misc Feature(30)order(4097..4099,4103..4105,4109..4111,4313..4315,
Misc Feature(31)order(4103..4111,4115..4117,4313..4315)
Misc Feature(32)order(4193..4195,4238..4243,4274..4279)
Misc Feature(33)order(4220..4225,4229..4231,4325..4327,4334..4336,
Misc Feature(34)4739..5185
Misc Feature(35)order(4739..4741,4745..4747,4808..4810,5057..5059,
Misc Feature(36)order(4760..4762,4766..4768,4772..4774,4976..4978)
Misc Feature(37)order(4766..4774,4778..4780,4976..4978)
Misc Feature(38)4793..4795
Misc Feature(39)order(4856..4858,4901..4906,4937..4942)
Misc Feature(40)order(4883..4888,4892..4894,4988..4990,4997..4999,
Misc Feature(41)5063..5065
Misc Feature(42)order(5255..5257,5258..5260)
Misc Feature(43)order(5306..5308,5864..5866)
Misc Feature(44)5318..5797
Misc Feature(45)order(5318..5320,5324..5326,5387..5389,5636..5638,
Misc Feature(46)order(5339..5341,5345..5347,5351..5353,5552..5554)
Misc Feature(47)order(5345..5353,5357..5359,5552..5554)
Misc Feature(48)order(5435..5437,5480..5485,5516..5521)
Misc Feature(49)order(5462..5467,5471..5473,5564..5566,5573..5575,
Misc Feature(50)order(5885..5887,5960..5962)
Misc Feature(51)order(6029..6031,6512..6514)
Misc Feature(52)6062..6553
Misc Feature(53)order(6098..6100,6503..6505)
Misc Feature(54)order(6164..6166,6617..6619)
Misc Feature(55)order(6227..6229,6251..6253)
Misc Feature(56)6656..6850
Misc Feature(57)6857..7012
Misc Feature(58)6896..7033
Misc Feature(59)7031..7213
Misc Feature(60)7541..7732
Misc Feature(61)7769..7777
Misc Feature(62)7994..8182
Misc Feature(63)order(8420..8422,8570..8572)
Misc Feature(64)8429..8674
Misc Feature(65)order(8465..8467,8612..8614)
Misc Feature(66)order(8498..8500,8660..8662)
Misc Feature(67)order(8510..8512,8666..8668)
Misc Feature(68)8561..8563
Misc Feature(69)8567..8569
Misc Feature(70)8681..8683
Exon (1)1..250
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (2)251..305
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (3)306..470
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (4)471..573
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (5)574..782
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (6)783..907
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (7)908..1124
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (8)1125..1247
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (9)1248..1359
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (10)1360..1406
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (11)1407..1543
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (12)1544..1682
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (13)1683..1783
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (14)1784..1979
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (15)1980..2195
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (16)2196..2436
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (17)2437..2531
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (18)2532..2692
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (19)2693..2796
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (20)2797..2935
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (21)2936..3070
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (22)3071..3217
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (23)3218..3358
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (24)3359..3472
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (25)3473..3629
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (26)3630..3788
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (27)3789..3924
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (28)3925..5303
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (29)5304..5420
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (30)5421..5561
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (31)5562..5705
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (32)5706..5870
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (33)5871..5914
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (34)5915..6092
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (35)6093..6313
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (36)6314..6506
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (37)6507..6848
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (38)6849..7048
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (39)7049..7151
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (40)7152..7226
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (41)7227..7331
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (42)7332..7537
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (43)7538..7687
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (44)7688..7798
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (45)7799..7979
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (46)7980..8020
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (47)8021..8137
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (48)8138..8236
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (49)8237..8365
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (50)8366..8405
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (51)8406..8503
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (52)8504..8833
Gene:VWF
Gene Synonym:F8VWF; VWD
Translation MIPARFAGVLLALALILPGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYL LAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYL ETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTL TSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPL VDPEPFVALCEKTLCECAGGLECACPALLEYARTCAQEGMVLYGWTDHSACSPVCPAGME YRQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVHSGKRYPPG TSLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQD HSFSIVIETVQCADDRDAVCTRSVTVRLPGLHNSLVKLKHGAGVAMDGQDVQLPLLKGDL RIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSG LAEPRVEDFGNAWKLHGDCQDLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVS PLPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVRVAWREPGRCELNCPKGQVYLQ CGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPED IFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADN LRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGE TVKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLVQDYCGS NPGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGR YIILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVD FGNSWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPY LDVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGY ECEWRYNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCE VAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGGLVVPPTDAPVSPTTLYVE DISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVE YHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRI TLLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVL SSVDELEQQRDEIVSYLCDLAPEAPPPTLPPDMAQVTVGPGLLGVSTLGPKRNSMVLDVA FVLEGSDKIGEADFNRSKEFMEEVIQRMDVGQDSIHVTVLQYSYMVTVEYPFSEAQSKGD ILQRVREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQAPNLVYMVTGNPASDEIKRLP GDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRCCSGEGLQIPTL SPAPDCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITT IDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILV TDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTM VTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCD RGLRPSCPNSQSPVKVEETCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQNK EQDLEVILHNGACSPGARQGCMKSIEVKHSALSVELHSDMEVTVNGRLVSVPYVGGNMEV NVYGAIMHEVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRD GTVTTDWKTLVQEWTVQRPGQTCQPILEEQCLVPDSSHCQVLLLPLFAECHKVLAPATFY AICQQDSCHQEQVCEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHC DGNVSSCGDHPSEGCFCPPDKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQI CTCLSGRKVNCTTQPCPTAKAPTCGLCEVARLRQNADQCCPEYECVCDPVSCDLPPVPHC ERGLQPTLTNPGECRPNFTCACRKEECKRVSPPSCPPHRLPTLRKTQCCDEYECACNCVN STVSCPLGYLASTATNDCGCTTTTCLPDKVCVHRSTIYPVGQFWEEGCDVCTCTDMEDAV MGLRVAQCSQKPCEDSCRSGFTYVLHEGECCGRCLPSACEVVTGSPRGDSQSSWKSVGSQ WASPENPCLINECVRVKEEVFIQQRNVSCPQLEVPVCPSGFQLSCKTSACCPSCRCERME ACMLNGTVIGPGKTVMIDVCTTCRCMVQVGVISGFKLECRKTTCNPCPLGYKEENNTGEC CGRCLPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHK CLAEGGKIMKIPGTCCDTCEEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMY SIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(113)-dbSNP:
complement(113)-t, cdbSNP:144257680
complement(127)-g, adbSNP:187439551
complement(271)-dbSNP:
complement(271)-g, adbSNP:144128523
complement(272)-t, cdbSNP:201015235
305+a, gdbSNP:61753983
complement(306)-dbSNP:
complement(306)-t, cdbSNP:267603621
complement(331)-g, adbSNP:140419498
complement(346)-t, cdbSNP:146778712
complement(347)-g, cdbSNP:368132716
350+c, g, tdbSNP:61753984
complement(357)-t, cdbSNP:374601266
364+c, tdbSNP:2229443
complement(369)-c, adbSNP:138001833
complement(376)-g, adbSNP:200710351
complement(385)-g, adbSNP:370840325
389+c, gdbSNP:61753985
397+a, cdbSNP:61753986
complement(411)-g, adbSNP:200901782
complement(412)-c, adbSNP:148741727
complement(415)-t, adbSNP:376119507
421+a, cdbSNP:61753987
complement(439)-t, cdbSNP:144310330
441+, gdbSNP:62643618
462+a, cdbSNP:62643619
complement(500)-dbSNP:
complement(500)-g, adbSNP:372664002
503+c, tdbSNP:62643620
complement(505)-g, adbSNP:369017115
complement(506)-t, cdbSNP:140044866
510+a, cdbSNP:62643621
526..527+, tdbSNP:61753989
526+, tdbSNP:61753988
complement(554)-t, cdbSNP:147514785
complement(577)-dbSNP:
complement(577)-g, adbSNP:369305347
complement(588)-t, cdbSNP:374854636
624..637+, ggtactacaagctgdbSNP:63749066
625..626+c, gtdbSNP:267607300
635+a, cdbSNP:61753991
640+c, tdbSNP:2229444
641+a, gdbSNP:76505074
complement(659)-c, adbSNP:71582882
complement(668)-t, cdbSNP:148218885
671+a, g, tdbSNP:61753992
672+a, gdbSNP:61753993
complement(679)-g, adbSNP:202062122
complement(689)-g, adbSNP:199939434
699+a, c, tdbSNP:61753994
complement(717)-t, cdbSNP:371953822
complement(727)-g, adbSNP:369559140
728+g, tdbSNP:61753995
747+a, tdbSNP:62643622
complement(756)-g, adbSNP:201312416
complement(765)-t, cdbSNP:200764995
complement(774)-g, adbSNP:201368895
complement(787)-dbSNP:
complement(787)-g, adbSNP:376006842
complement(795)-g, adbSNP:372719492
complement(796)-t, cdbSNP:143054357
complement(814)-g, adbSNP:200204308
complement(855)-t, cdbSNP:369737556
complement(873)-g, cdbSNP:377057638
902+c, tdbSNP:62643623
916+dbSNP:
916+a, gdbSNP:62643624
complement(932)-g, adbSNP:371453614
complement(945)-g, adbSNP:367571869
complement(956)-g, adbSNP:140912382
complement(959)-t, adbSNP:374004459
complement(977)-g, adbSNP:372100774
complement(978)-g, adbSNP:370654988
complement(980)-t, cdbSNP:137987854
1038..1061+, gcgcctgccctgccctcctggagtdbSNP:63749067
complement(1040)-t, cdbSNP:145476045
complement(1046)-g, cdbSNP:201450675
complement(1049)-t, cdbSNP:140388695
1067+c, tdbSNP:61753997
1073+a, c, tdbSNP:61753998
complement(1100)-t, cdbSNP:376461502
complement(1119)-g, adbSNP:375397606
complement(1120)-t, cdbSNP:150192701
1143..1144+dbSNP:
1143..1144+, gdbSNP:267607303
complement(1155)-g, cdbSNP:140911166
complement(1167)-g, cdbSNP:200097381
complement(1175)-c, adbSNP:200615283
complement(1182)-g, adbSNP:201496129
1204+a, tdbSNP:1800387
complement(1204)-t, adbSNP:386504238
1220+c, tdbSNP:61754000
1221+a, gdbSNP:61754001
complement(1224)-c, adbSNP:11837584
complement(1225)-g, adbSNP:199928277
1238..1239+, adbSNP:267607304
complement(1242)-t, cdbSNP:140004667
complement(1243)-t, gdbSNP:147924974
complement(1252)-dbSNP:
complement(1252)-t, adbSNP:368187449
complement(1269)-c, adbSNP:370201773
complement(1279)-t, cdbSNP:373418673
complement(1287)-g, adbSNP:111971143
complement(1300)-g, adbSNP:141009309
complement(1317)-t, cdbSNP:377580592
1321+a, cdbSNP:61754002
complement(1325)-g, adbSNP:146154234
complement(1327)-g, adbSNP:71582884
complement(1328)-t, cdbSNP:199570108
complement(1341)-g, adbSNP:373521756
1343+c, tdbSNP:61754003
complement(1356)-g, adbSNP:370984009
complement(1357)-g, cdbSNP:149640698
1367+dbSNP:
1367+c, tdbSNP:62643625
1368+c, tdbSNP:78516266
complement(1371)-c, adbSNP:201185151
complement(1372..1373)-, gdbSNP:141400724
1381+g, tdbSNP:62643626
complement(1407)-dbSNP:
complement(1407)-c, adbSNP:367556535
1423+a, tdbSNP:1800375
complement(1429)-t, cdbSNP:367960031
1432+a, cdbSNP:1800376
1462..1463+, aatcccdbSNP:61754006
complement(1472)-t, cdbSNP:201306785
complement(1490)-t, gdbSNP:375451251
complement(1496)-g, adbSNP:185908682
complement(1497)-t, cdbSNP:137950753
complement(1505)-g, adbSNP:201379649
1530+a, tdbSNP:61754007
complement(1533)-t, adbSNP:370628384
complement(1556)-dbSNP:
complement(1556)-g, adbSNP:145443126
1559..1576+, gacgctgtgtgcacccgcdbSNP:267607305
complement(1559)-c, adbSNP:375486035
complement(1561)-g, adbSNP:374722386
complement(1569)-t, cdbSNP:372938917
complement(1574)-g, adbSNP:148247755
complement(1575)-t, cdbSNP:199665748
complement(1579)-g, adbSNP:142404899
complement(1580)-t, cdbSNP:149116506
complement(1582)-g, adbSNP:112620124
complement(1585)-g, adbSNP:368896272
complement(1589)-g, adbSNP:372495746
complement(1593)-g, adbSNP:377243998
complement(1643)-g, cdbSNP:372738366
complement(1646)-t, cdbSNP:201345218
complement(1660)-g, adbSNP:111867665
1661+a, gdbSNP:1800377
complement(1691)-dbSNP:
complement(1691)-g, adbSNP:186112213
complement(1700)-g, adbSNP:199771680
1701+a, gdbSNP:1800378
complement(1702)-t, adbSNP:147913451
complement(1706)-t, cdbSNP:372734168
complement(1711)-t, cdbSNP:369933210
complement(1713)-g, cdbSNP:144817575
complement(1717)-g, adbSNP:377066810
complement(1721)-g, adbSNP:372904370
complement(1733)-t, cdbSNP:369852695
complement(1764)-t, cdbSNP:139830291
complement(1765)-g, adbSNP:377198574
complement(1766)-t, cdbSNP:201456647
complement(1769)-t, cdbSNP:189409574
1798+dbSNP:
1798+c, tdbSNP:1800379
complement(1801)-t, gdbSNP:142956629
complement(1812)-g, cdbSNP:148591481
1823+a, gdbSNP:267607306
1833+a, gdbSNP:61754010
complement(1844)-g, cdbSNP:200291678
complement(1846)-g, adbSNP:111240043
complement(1856)-g, adbSNP:377501452
complement(1860)-, gdbSNP:35879738
complement(1863)-g, adbSNP:139196998
complement(1864)-g, adbSNP:138268387
complement(1875)-g, cdbSNP:141649383
1876+a, c, gdbSNP:35365059
complement(1888)-t, cdbSNP:370416209
complement(1897..1898)-, cdbSNP:34625593
1898+a, gdbSNP:61754011
1907..1908+, tdbSNP:267607307
complement(1931)-t, cdbSNP:376162697
1959+c, gdbSNP:61754013
complement(1972)-t, cdbSNP:368329035
complement(1978)-c, adbSNP:150146744
complement(2003)-dbSNP:
complement(2003)-t, cdbSNP:141777100
complement(2026)-g, adbSNP:370058863
2031+c, gdbSNP:267607308
complement(2044)-t, cdbSNP:35302737
complement(2067)-t, cdbSNP:200586078
2080+a, cdbSNP:61754015
complement(2098)-g, cdbSNP:372835093
2108+c, g, tdbSNP:61754016
2119+c, gdbSNP:61754017
2123..2124+, gcgdbSNP:61754018
2134+c, tdbSNP:34237676
complement(2142)-g, adbSNP:199963222
2172+c, tdbSNP:61754019
2176+a, gdbSNP:61754666
2180+g, tdbSNP:61748460
complement(2208)-dbSNP:
complement(2208)-g, adbSNP:11064012
complement(2241)-g, adbSNP:202186148
complement(2252)-t, gdbSNP:201886182
2266..2269+, ctctdbSNP:61748462
complement(2269..2270)-, agdbSNP:371126726
complement(2274)-g, adbSNP:200087139
complement(2282)-t, cdbSNP:267603620
complement(2321)-t, gdbSNP:199623726
2322+, cdbSNP:267607309
complement(2344)-t, cdbSNP:141590700
complement(2348)-g, cdbSNP:377672051
complement(2353)-g, adbSNP:78995469
complement(2358)-g, adbSNP:377240952
2366+c, tdbSNP:61748463
2374..2375+, ctdbSNP:61748464
complement(2384)-t, cdbSNP:372280803
complement(2386)-g, adbSNP:146468788
2407+, adbSNP:62643628
complement(2426)-g, adbSNP:369273301
complement(2449)-dbSNP:
complement(2449)-g, adbSNP:200848454
complement(2457)-g, adbSNP:149168790
2470+a, gdbSNP:2228317
complement(2482)-g, adbSNP:186850965
complement(2483)-t, cdbSNP:367811486
2519..2520+, ctdbSNP:61748465
2528+c, tdbSNP:61748466
2529+a, gdbSNP:61748467
complement(2532)-dbSNP:
complement(2532)-t, cdbSNP:77853528
2534+a, gdbSNP:267607310
2537+a, gdbSNP:61748469
complement(2545)-t, cdbSNP:150043098
complement(2555)-t, g, adbSNP:143145764
complement(2558)-g, adbSNP:149051646
complement(2562)-g, adbSNP:199588249
2563+g, tdbSNP:61748470
complement(2582)-t, cdbSNP:146892641
complement(2590)-g, cdbSNP:143904314
complement(2591)-g, adbSNP:189056533
2594+c, tdbSNP:61748471
2595+a, c, gdbSNP:61748472
2604+a, gdbSNP:61748473
complement(2608)-g, cdbSNP:201435268
2609+a, gdbSNP:61748474
2612+c, tdbSNP:61748475
2613+a, gdbSNP:61748476
2615+a, c, gdbSNP:1063856
complement(2615)-t, cdbSNP:386514644
2622+c, tdbSNP:61748477
2634+a, gdbSNP:61748478
2635+c, tdbSNP:1063857
complement(2639)-g, adbSNP:374016797
complement(2647)-g, adbSNP:377151690
2648+a, gdbSNP:61748479
complement(2659)-g, cdbSNP:369828268
2661+g, tdbSNP:62643630
2685+, cdbSNP:62643632
2685+c, tdbSNP:62643631
2696+dbSNP:
2696+c, tdbSNP:121964894
2697+a, gdbSNP:62643634
complement(2701)-t, adbSNP:57950734
complement(2727)-t, cdbSNP:368825064
complement(2728)-g, cdbSNP:374958989
complement(2747)-t, cdbSNP:151048762
complement(2760)-t, gdbSNP:75645183
complement(2763)-g, adbSNP:149520234
2765+, gdbSNP:61748481
complement(2786)-c, adbSNP:200106723
2790..2791+, adbSNP:267607311
complement(2805)-dbSNP:
complement(2805)-t, cdbSNP:216321
2810+c, tdbSNP:61748482
complement(2811)-t, cdbSNP:41276738
2823+g, tdbSNP:61748484
complement(2824)-g, cdbSNP:184227165
complement(2825)-t, cdbSNP:371017187
complement(2836)-t, gdbSNP:34510401
complement(2841)-t, cdbSNP:146405753
complement(2853)-g, cdbSNP:376980353
complement(2860)-g, adbSNP:141982646
complement(2861)-t, cdbSNP:148122508
complement(2876)-g, adbSNP:143762054
complement(2882)-t, adbSNP:148969007
complement(2884)-g, adbSNP:113240752
2885+a, gdbSNP:61748485
2891+, cdbSNP:61748486
complement(2901)-c, adbSNP:146850658
complement(2904)-g, adbSNP:11064002
complement(2906)-g, adbSNP:141451322
complement(2912)-g, cdbSNP:373780244
complement(2924)-t, cdbSNP:201072235
complement(2944)-dbSNP:
complement(2944)-g, adbSNP:201892996
complement(2945)-t, cdbSNP:142135013
2984..2985+, tdbSNP:61748490
2989+a, cdbSNP:35191786
3020+c, tdbSNP:61748491
complement(3021)-t, cdbSNP:33978901
complement(3025)-g, adbSNP:369167738
complement(3035)-t, cdbSNP:376037865
complement(3051)-g, adbSNP:142563352
complement(3064)-g, adbSNP:139622018
complement(3065)-t, cdbSNP:147408448
complement(3089)-dbSNP:
complement(3089)-t, cdbSNP:142861582
complement(3113)-c, adbSNP:374622681
complement(3128)-g, adbSNP:370984712
3130+a, gdbSNP:1800380
complement(3145)-g, cdbSNP:144225315
complement(3149)-t, cdbSNP:149573046
complement(3150)-t, cdbSNP:141087261
complement(3156)-g, adbSNP:202175420
complement(3163)-g, adbSNP:372588372
complement(3164)-t, cdbSNP:150418484
complement(3177)-t, cdbSNP:181452677
3186+a, gdbSNP:267607312
complement(3193)-g, adbSNP:369031938
complement(3194)-g, cdbSNP:376548659
3236+dbSNP:
3236+g, tdbSNP:61748493
complement(3258)-t, cdbSNP:141477932
complement(3263)-t, cdbSNP:367549408
complement(3272)-t, cdbSNP:138940478
complement(3273)-t, gdbSNP:374126602
3322+, cdbSNP:267607313
complement(3337)-t, cdbSNP:372073860
complement(3339)-t, cdbSNP:145125264
complement(3342)-t, cdbSNP:141412860
complement(3351..3353)-, tggdbSNP:368366214
complement(3353)-t, cdbSNP:146648301
complement(3394)-dbSNP:
complement(3394)-g, adbSNP:201874365
3409+g, tdbSNP:61748496
complement(3425)-g, adbSNP:374339543
3428+c, tdbSNP:61748497
3429+a, gdbSNP:267607314
complement(3441)-t, gdbSNP:143024162
3462+g, tdbSNP:267607315
3482+dbSNP:
3482+a, gdbSNP:267607316
complement(3490)-g, adbSNP:4021576
complement(3490)-g, adbSNP:111326850
complement(3508)-g, adbSNP:112634786
3531+c, tdbSNP:267607317
complement(3541)-g, adbSNP:149895348
complement(3551)-g, c, adbSNP:202034414
3553+c, g, tdbSNP:267607318
complement(3557)-t, gdbSNP:113805591
3570+a, gdbSNP:267607319
complement(3571)-g, adbSNP:199851395
3582+a, gdbSNP:267607320
3609+c, gdbSNP:267607321
complement(3615)-g, adbSNP:183119284
complement(3616)-t, cdbSNP:373172467
complement(3629)-g, adbSNP:139579968
3635..3636+dbSNP:
3635..3636+, agdbSNP:267607322
3638+c, g, tdbSNP:267607323
3639+g, tdbSNP:267607324
3680+g, tdbSNP:267607325
3687+a, gdbSNP:267607326
3695+c, tdbSNP:61748511
3710+c, tdbSNP:267607327
3717+c, tdbSNP:267607328
3720+g, tdbSNP:267607329
3761+c, gdbSNP:267607330
3788+a, gdbSNP:267607332
complement(3797)-dbSNP:
complement(3797)-g, cdbSNP:147818186
complement(3799)-g, cdbSNP:144447692
complement(3808)-c, adbSNP:3741908
3818+c, tdbSNP:61749364
complement(3820)-g, adbSNP:372114325
complement(3821)-t, cdbSNP:368327275
complement(3829)-g, adbSNP:16933969
complement(3833)-c, adbSNP:374591991
3836+c, tdbSNP:61749365
complement(3840)-g, adbSNP:372171661
complement(3844)-c, adbSNP:368522060
complement(3863)-g, adbSNP:373787920
3864+a, g, tdbSNP:121964895
3923+g, tdbSNP:267607333
3929+dbSNP:
3929+c, tdbSNP:61749366
3936+g, tdbSNP:61749367
3942+a, c, gdbSNP:61749368
3952+g, tdbSNP:61749369
complement(3969)-g, adbSNP:150576611
complement(3970)-t, cdbSNP:141792415
complement(3985)-t, cdbSNP:148499318
complement(3997)-g, adbSNP:200893595
complement(3999)-g, cdbSNP:144691240
complement(4039)-t, cdbSNP:199831474
4045+a, gdbSNP:112026952
complement(4045)-g, adbSNP:2228319
4047+a, c, tdbSNP:61749370
4052+a, c, gdbSNP:61749371
4064..4065+, atttctactdbSNP:63524160
4064+c, g, tdbSNP:61749372
4065+c, g, tdbSNP:63524161
4077+c, tdbSNP:61749374
4081..4083+, cctdbSNP:61749375
4085+a, g, tdbSNP:61749376
4095..4096+, tcctgctdbSNP:61749377
4095+g, tdbSNP:61749378
4103+c, tdbSNP:61749379
4104+c, tdbSNP:61749380
4113+g, tdbSNP:267607334
complement(4117)-g, adbSNP:375398751
complement(4118)-t, cdbSNP:138900040
4127+c, tdbSNP:267607335
4137+c, tdbSNP:61749381
4155+a, gdbSNP:61749382
4160+a, gdbSNP:267607336
4162..4163+, atgdbSNP:61749383
4166+c, tdbSNP:61749384
4167+a, g, tdbSNP:61749385
4170+c, tdbSNP:61749386
4172+c, tdbSNP:61749387
4173+a, c, gdbSNP:61749388
4175+a, gdbSNP:61749389
4179+c, tdbSNP:61749390
4181+c, tdbSNP:267607337
4189+c, gdbSNP:61749392
4190+c, g, tdbSNP:61749393
4191+a, tdbSNP:61749394
4193+c, tdbSNP:61749395
4194+a, g, tdbSNP:61749396
complement(4195)-g, adbSNP:143009893
4196+a, gdbSNP:61749397
complement(4202)-t, cdbSNP:372028373
complement(4217)-t, cdbSNP:369628563
4220+a, gdbSNP:61749398
4221+c, gdbSNP:61749399
complement(4237)-g, cdbSNP:138413641
4260+c, tdbSNP:61749400
4261+a, gdbSNP:1800381
4263+c, gdbSNP:61749401
4271+c, tdbSNP:61749402
4272+a, c, g, tdbSNP:61749403
4274+c, tdbSNP:61749404
complement(4277)-t, cdbSNP:150923481
4286+c, tdbSNP:61749405
complement(4300)-t, cdbSNP:143459496
4325+a, gdbSNP:61749407
4329+c, tdbSNP:267607338
4332+c, tdbSNP:61749408
4335+a, cdbSNP:61750067
4342..4343+, acdbSNP:61750068
complement(4342)-t, cdbSNP:375193686
complement(4352)-t, cdbSNP:199703097
complement(4353)-g, adbSNP:199675425
4355+a, tdbSNP:61750069
4365+g, tdbSNP:61750070
4370+a, c, tdbSNP:61750071
4371+a, g, tdbSNP:61750072
complement(4380)-g, adbSNP:141211612
4383+c, tdbSNP:61750073
4385+c, tdbSNP:61750074
complement(4388)-t, cdbSNP:11063988
4391+a, gdbSNP:216311
complement(4396)-c, adbSNP:140464171
4398+c, g, tdbSNP:61750075
complement(4417)-t, cdbSNP:201895432
4423..4455+, acggatgtcccggaactttgtccgctacgtccadbSNP:63749069
complement(4423)-t, cdbSNP:145009516
complement(4432)-g, adbSNP:139215659
4445+c, tdbSNP:61750077
complement(4456)-t, cdbSNP:368639720
4472..4474+, aagdbSNP:61750078
complement(4472)-t, gdbSNP:141990425
4488+c, tdbSNP:61750079
4494+a, gdbSNP:61750080
4497+a, tdbSNP:61750081
complement(4505)-t, gdbSNP:375498783
4513+c, gdbSNP:61750082
4523+a, tdbSNP:61750083
complement(4531)-g, adbSNP:140077306
complement(4535)-t, cdbSNP:371554756
complement(4554)-t, cdbSNP:11063987
4559+a, gdbSNP:61750084
complement(4565)-t, cdbSNP:150077670
4589+c, gdbSNP:61750085
complement(4603)-g, adbSNP:367638908
4618+a, c, gdbSNP:61750086
4623+a, gdbSNP:61750087
4628+c, gdbSNP:61750088
4632+a, c, tdbSNP:61750089
4634+c, gdbSNP:61750090
4649+c, tdbSNP:61750091
complement(4663)-g, adbSNP:374092740
4664..4665+, cdbSNP:267607339
4664+c, gdbSNP:1800383
4665..4666+, gdbSNP:61750093
4673+c, tdbSNP:61750094
complement(4693)-c, adbSNP:144796763
complement(4701)-t, cdbSNP:267603619
4703+, gdbSNP:61750095
complement(4707)-g, adbSNP:149424724
complement(4708)-t, cdbSNP:138966048
4749+a, cdbSNP:61750096
4758+a, c, g, tdbSNP:61750097
4763+c, gdbSNP:61750098
4764+a, gdbSNP:61750099
complement(4765)-t, cdbSNP:370799437
4767+c, tdbSNP:61750100
complement(4768)-t, cdbSNP:146928422
complement(4777)-g, adbSNP:141174823
4791+g, tdbSNP:61750101
4802+a, gdbSNP:61750102
4820+, gdbSNP:61750103
complement(4826)-g, adbSNP:267603618
complement(4835)-g, cdbSNP:138670575
4854..4862+, tccacgtcadbSNP:267607340
complement(4863)-g, adbSNP:377512022
4866+a, tdbSNP:267607341
4869+c, tdbSNP:267607342
4876+c, gdbSNP:267607343
4878+c, tdbSNP:267607344
4885+, gdbSNP:267607345
4887..4895+, tgactgtggdbSNP:267607346
complement(4891)-g, adbSNP:216310
4895+a, gdbSNP:267607347
complement(4901)-t, gdbSNP:186559034
complement(4909)-g, adbSNP:375675510
complement(4911)-t, cdbSNP:182250388
4915+a, cdbSNP:1800384
complement(4915)-c, adbSNP:41456147
4917+a, gdbSNP:61750110
4935+c, tdbSNP:61750111
complement(4940)-g, adbSNP:370854023
4943+g, tdbSNP:1800385
complement(4943)-c, adbSNP:56286209
4946+c, tdbSNP:61750112
4953+a, tdbSNP:267607348
complement(4955)-g, adbSNP:61909722
complement(4963)-c, adbSNP:144474530
complement(4966)-g, adbSNP:199604081
4967+a, gdbSNP:267607349
4985+a, gdbSNP:61750113
4988+c, gdbSNP:61750114
4989+c, tdbSNP:61750115
4997+c, tdbSNP:61750116
5001+a, gdbSNP:1800386
complement(5007)-g, adbSNP:373898451
5039+c, g, tdbSNP:61750117
5040+a, g, tdbSNP:61750577
complement(5049)-g, adbSNP:376943868
complement(5050)-t, cdbSNP:201264909
5058+c, tdbSNP:267607350
5060+g, tdbSNP:61750578
5070+a, tdbSNP:61750579
complement(5074)-g, adbSNP:142635883
5075+a, gdbSNP:61750580
5087+c, tdbSNP:61750581
5091+a, gdbSNP:61750582
complement(5104)-t, cdbSNP:372494165
complement(5126)-c, adbSNP:369291547
5130+a, cdbSNP:61750583
5133+c, tdbSNP:61750584
5135+a, gdbSNP:61750585
5136+, gdbSNP:61750586
5139+a, tdbSNP:61750587
complement(5155)-g, adbSNP:148901164
complement(5156)-t, cdbSNP:145676400
5162+a, gdbSNP:61750588
5166+c, tdbSNP:61750589
complement(5167)-t, cdbSNP:146596289
complement(5173)-t, cdbSNP:140001946
complement(5176)-g, adbSNP:200147615
5192+c, tdbSNP:61750590
5193+c, gdbSNP:267607351
complement(5194)-g, adbSNP:201825372
5194+, tdbSNP:61750591
complement(5218)-t, cdbSNP:143838793
5219+a, cdbSNP:61750592
5220+a, tdbSNP:61750593
5221..5222+, cdbSNP:61750594
5225+c, tdbSNP:61750595
5244+a, tdbSNP:61750596
5254+g, tdbSNP:61750597
5264+a, gdbSNP:61750598
5273..5274+ct, tadbSNP:61750599
5289+g, tdbSNP:397840484
complement(5299)-t, gdbSNP:200368994
complement(5315)-dbSNP:
complement(5315)-t, gdbSNP:139320345
complement(5349)-g, adbSNP:369529543
complement(5379)-g, adbSNP:375946218
complement(5389)-g, adbSNP:150873446
complement(5406)-t, gdbSNP:74509284
complement(5415)-t, cdbSNP:372748722
complement(5423)-dbSNP:
complement(5423)-g, adbSNP:78302129
complement(5427)-t, cdbSNP:147313320
5430..5431+, ttdbSNP:61750602
5441+a, tdbSNP:61750603
complement(5450)-g, adbSNP:374707563
complement(5469)-g, adbSNP:371539649
5485+g, tdbSNP:267607352
complement(5519)-g, adbSNP:376888924
complement(5527)-g, adbSNP:41276736
5528+a, gdbSNP:61750604
complement(5535)-t, cdbSNP:199729586
complement(5538)-t, cdbSNP:373074982
complement(5561)-t, cdbSNP:370016586
5563+dbSNP:
5563+g, tdbSNP:2229448
5571+c, tdbSNP:61750605
5585+c, tdbSNP:61750606
complement(5588)-c, adbSNP:372002214
5597+g, tdbSNP:267607353
complement(5604)-g, adbSNP:150349730
5606+c, gdbSNP:267607354
complement(5620)-t, cdbSNP:71582868
5630+a, gdbSNP:267607355
complement(5634)-g, adbSNP:146729537
complement(5639)-t, cdbSNP:374312131
complement(5653)-t, cdbSNP:367952240
5703+a, gdbSNP:61750608
complement(5713)-dbSNP:
complement(5713)-t, cdbSNP:375662234
5715+g, tdbSNP:61750609
5721+a, cdbSNP:61750610
complement(5723)-t, cdbSNP:372430819
complement(5736)-t, cdbSNP:143445274
complement(5739)-t, cdbSNP:370511668
complement(5742)-t, cdbSNP:186798928
complement(5765)-g, adbSNP:141134620
complement(5768)-c, adbSNP:376350586
complement(5783)-t, cdbSNP:201548925
complement(5791)-g, adbSNP:146540001
complement(5792)-t, cdbSNP:376993019
5795+a, gdbSNP:61750611
5807+c, tdbSNP:61750612
complement(5813)-t, cdbSNP:139711566
complement(5847)-g, adbSNP:267603617
complement(5850)-g, adbSNP:200461577
complement(5881)-dbSNP:
complement(5881)-t, cdbSNP:144221902
complement(5917)-dbSNP:
complement(5917)-g, adbSNP:56981471
complement(5923)-g, adbSNP:369450995
complement(5954)-t, cdbSNP:144757652
complement(6027)-g, adbSNP:375136778
complement(6035)-t, adbSNP:149799233
complement(6047)-g, adbSNP:372572865
complement(6051)-c, adbSNP:139845585
complement(6094)-dbSNP:
complement(6094)-g, adbSNP:216902
complement(6095)-t, cdbSNP:374459416
complement(6101)-t, cdbSNP:144072210
complement(6104)-t, cdbSNP:113237579
6140+a, cdbSNP:267607356
complement(6159)-t, cdbSNP:370223669
6191+g, tdbSNP:61750613
complement(6215)-g, cdbSNP:199924971
complement(6229)-g, adbSNP:200642838
complement(6250)-g, adbSNP:376954444
complement(6266)-t, cdbSNP:140229844
complement(6289)-g, adbSNP:200034511
complement(6302)-t, cdbSNP:185374140
complement(6319)-dbSNP:
complement(6319)-t, cdbSNP:375810839
complement(6337)-g, cdbSNP:371791695
complement(6349)-g, adbSNP:55784921
complement(6354)-t, cdbSNP:186806674
complement(6372)-t, cdbSNP:141949957
complement(6376)-g, adbSNP:201819291
complement(6388)-g, cdbSNP:183640579
6432+, tdbSNP:61750614
6437+c, tdbSNP:61750615
complement(6469)-g, adbSNP:147982896
complement(6492)-g, adbSNP:368207430
complement(6500)-g, cdbSNP:192374602
complement(6505)-g, adbSNP:201189728
complement(6527)-dbSNP:
complement(6527)-g, cdbSNP:149274687
complement(6531)-t, cdbSNP:199546602
complement(6552)-t, cdbSNP:371105544
complement(6553)-t, gdbSNP:115914543
6561+c, tdbSNP:61750616
complement(6570)-c, adbSNP:377640206
complement(6589)-t, cdbSNP:373520757
6595+a, tdbSNP:11537642
complement(6602)-g, adbSNP:200719767
complement(6603)-t, cdbSNP:375779188
complement(6616)-t, cdbSNP:141097321
complement(6625)-g, cdbSNP:373120381
complement(6627)-g, adbSNP:71579338
6635+g, tdbSNP:61750617
complement(6655)-g, cdbSNP:146529302
complement(6674)-g, adbSNP:190741083
6683+c, tdbSNP:61750618
complement(6713)-t, cdbSNP:368419568
complement(6723)-g, adbSNP:201394479
6770+g, tdbSNP:61750619
complement(6782)-t, gdbSNP:34230288
6786+c, tdbSNP:61750620
6804+a, gdbSNP:2229446
complement(6811)-g, adbSNP:151250563
complement(6820)-g, adbSNP:368877141
6870+dbSNP:
6870+c, tdbSNP:61750622
complement(6890)-g, adbSNP:201195374
complement(6902)-g, adbSNP:200382972
complement(6916)-t, gdbSNP:199831766
complement(6918)-t, gdbSNP:369015684
complement(6919)-g, adbSNP:149847513
complement(6924)-t, cdbSNP:142316574
complement(6927)-t, gdbSNP:181987927
6947+c, gdbSNP:61750623
complement(6988)-g, adbSNP:61731159
complement(7006)-t, cdbSNP:71581020
complement(7018)-g, cdbSNP:200300292
7019+a, tdbSNP:62643638
complement(7034)-t, cdbSNP:147715696
7096+dbSNP:
7096+a, gdbSNP:1053523
7109+c, tdbSNP:61750625
complement(7128)-g, adbSNP:142921275
complement(7140)-g, adbSNP:201372397
complement(7144)-t, cdbSNP:147523582
complement(7158)-dbSNP:
complement(7158)-g, adbSNP:149432685
complement(7159)-t, cdbSNP:371531354
7161+a, gdbSNP:61750626
complement(7166)-g, adbSNP:138997660
complement(7168)-g, cdbSNP:144777030
complement(7181)-g, adbSNP:150725355
7182+a, gdbSNP:267607357
complement(7187)-t, g, adbSNP:184921605
7188+a, gdbSNP:62641242
complement(7199)-t, cdbSNP:138618444
complement(7215)-t, adbSNP:201792015
complement(7228)-dbSNP:
complement(7228)-t, cdbSNP:372561152
complement(7257)-g, adbSNP:144769404
7268+c, tdbSNP:61750628
complement(7274)-g, adbSNP:142612858
complement(7275)-g, adbSNP:34120165
7278+g, tdbSNP:61750629
complement(7309)-g, cdbSNP:112319661
complement(7330)-g, adbSNP:111597150
7335+dbSNP:
7335+g, tdbSNP:61750630
complement(7367)-g, adbSNP:148908677
7375..7376+, cdbSNP:267607359
7380..7381+, cdbSNP:267607360
complement(7380)-g, adbSNP:368646629
7385+c, tdbSNP:61751283
7387..7388+, tdbSNP:267607361
complement(7400)-g, adbSNP:145697622
complement(7401)-t, cdbSNP:150201871
complement(7423)-t, cdbSNP:374329353
complement(7424)-g, adbSNP:181290699
7426+g, tdbSNP:61751285
complement(7441)-g, adbSNP:142422347
complement(7457)-t, cdbSNP:147705313
complement(7470)-g, adbSNP:201494706
complement(7486)-t, gdbSNP:145450160
complement(7489)-g, adbSNP:216867
complement(7531)-g, adbSNP:151303589
7544..7545+dbSNP:
7544..7545+, gtdbSNP:62643639
7550+c, g, tdbSNP:62643640
complement(7551)-t, cdbSNP:370600984
7571+g, tdbSNP:62643641
complement(7576)-c, adbSNP:139290955
complement(7579)-g, adbSNP:142444263
complement(7594)-g, adbSNP:55944252
complement(7611)-t, gdbSNP:200486416
complement(7612)-g, adbSNP:146504585
complement(7627)-g, adbSNP:142452106
complement(7628)-t, cdbSNP:149677556
7640+c, tdbSNP:61751286
complement(7641)-c, adbSNP:373896832
complement(7642)-g, adbSNP:149984396
7643..7644+, cgtgatgggcctccgcgdbSNP:267607362
complement(7643)-t, cdbSNP:375655409
7655+c, tdbSNP:61751287
7658+c, tdbSNP:61751288
7680+a, c, gdbSNP:61751289
complement(7683)-t, cdbSNP:111752224
7687+a, gdbSNP:267607363
7699..7700+dbSNP:
7699..7700+, adbSNP:61751291
complement(7699)-g, adbSNP:369629756
complement(7700)-t, cdbSNP:139864572
7739+c, tdbSNP:61751292
complement(7743)-t, gdbSNP:369669154
complement(7767)-g, adbSNP:181094101
complement(7768)-t, cdbSNP:368010532
complement(7769)-g, adbSNP:368286307
complement(7801)-dbSNP:
complement(7801)-g, adbSNP:145955543
7802+a, gdbSNP:61751293
7809+a, cdbSNP:61751294
complement(7821)-g, adbSNP:374690023
complement(7840)-g, cdbSNP:369878547
7849+a, tdbSNP:61751295
7853+c, tdbSNP:61751296
complement(7854)-t, cdbSNP:137987906
complement(7869)-g, adbSNP:150778949
complement(7875)-t, adbSNP:201213029
7880+c, tdbSNP:61751297
7886+a, tdbSNP:61751298
complement(7899)-g, adbSNP:376366370
7914..7915+, agdbSNP:267607364
complement(7916)-t, cdbSNP:372582651
complement(7922)-g, adbSNP:202068340
complement(7923)-g, adbSNP:373158962
7924..7925+, cdbSNP:267607365
7932+a, tdbSNP:35335161
7933+, tdbSNP:61751300
7948+a, gdbSNP:16932285
complement(7957)-t, cdbSNP:143235468
complement(7964)-g, adbSNP:368810263
complement(7969)-t, gdbSNP:192262780
complement(7973)-g, adbSNP:375991463
complement(7974)-t, cdbSNP:373321657
complement(7978)-g, adbSNP:369734683
complement(7982)-dbSNP:
complement(7982)-g, adbSNP:369970893
complement(7997)-t, gdbSNP:371687405
complement(8011)-g, adbSNP:367671063
complement(8016)-g, adbSNP:374131634
complement(8023)-dbSNP:
complement(8023)-g, adbSNP:375117638
complement(8024)-t, cdbSNP:142316324
complement(8050)-g, adbSNP:200209213
complement(8052)-g, adbSNP:138303680
complement(8061)-t, cdbSNP:147052620
complement(8083)-g, adbSNP:111619561
complement(8099)-g, adbSNP:371948517
complement(8126)-t, gdbSNP:141666705
complement(8136)-t, c, adbSNP:112100565
complement(8155)-dbSNP:
complement(8155)-g, adbSNP:201953086
8190+c, tdbSNP:61751302
complement(8196)-c, adbSNP:202052078
complement(8231)-g, adbSNP:199968654
complement(8237)-dbSNP:
complement(8237)-g, adbSNP:370662678
complement(8238)-g, cdbSNP:149834874
complement(8247)-g, adbSNP:78353028
complement(8248)-t, cdbSNP:201890452
8262+a, gdbSNP:61751303
complement(8285)-t, cdbSNP:377514450
complement(8286)-t, cdbSNP:151129435
complement(8298)-t, cdbSNP:144511926
complement(8318)-c, adbSNP:200389567
8328+a, gdbSNP:62641243
complement(8329)-g, adbSNP:41276732
complement(8334)-g, cdbSNP:76459136
complement(8344)-t, cdbSNP:144030544
complement(8363)-t, cdbSNP:7962217
complement(8410)-dbSNP:
complement(8410)-t, cdbSNP:368802960
8414+c, gdbSNP:62641244
complement(8432)-t, adbSNP:199871749
8437..8444+, caggctgcdbSNP:267607367
complement(8437)-g, cdbSNP:375985267
8466+a, gdbSNP:61751305
8491..8499+, ccactactgdbSNP:267607368
8512+dbSNP:
8512+g, tdbSNP:61751306
complement(8523)-g, adbSNP:144542595
complement(8539)-g, adbSNP:149309674
8561+a, tdbSNP:61751307
8562+a, gdbSNP:61751308
8566+, cdbSNP:61751309
8567+c, tdbSNP:61751310
8568+c, gdbSNP:61751311
complement(8574)-g, adbSNP:376285757
complement(8575)-g, adbSNP:138588762
8577+c, tdbSNP:61751312
complement(8582)-g, adbSNP:368634026
complement(8583)-t, cdbSNP:150577615
complement(8586)-g, adbSNP:374314985
complement(8587)-t, cdbSNP:201741225
8591+c, tdbSNP:61751313
complement(8616)-g, cdbSNP:371036946
complement(8628)-g, adbSNP:143743709
8632+g, tdbSNP:3087517
complement(8641)-t, cdbSNP:368635198
8652+a, cdbSNP:267607369
8661+a, gdbSNP:267607370
8662..8663+, tccccdbSNP:267607371
8666+c, tdbSNP:267607372
complement(8689)-t, cdbSNP:138263930
Gene SymbolVWF
Gene SynonymF8VWF; VWD
Chromosome12
Locus Map12p13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000552 Homo sapiens von Willebrand factor (VWF), mRNA. In-stock $2448.00 $2399.00 24
Title Single particle tracking of ADAMTS13 (a disintegrin and metalloprotease with thrombospondin type-1 repeats) molecules on endothelial von Willebrand factor strings .
Author De Ceunynck K, Rocha S, De Meyer SF, Sadler JE, Uji-i H, Deckmyn H, Hofkens J and Vanhoorelbeke K.
Journal J. Biol. Chem. 289 (13), 8903-8915 (2014)
Title Highly reinforced structure of a C-terminal dimerization domain in von Willebrand factor .
Author Zhou YF and Springer TA.
Journal Blood 123 (12), 1785-1793 (2014)
Title Structural basis of regulation of von Willebrand factor binding to glycoprotein Ib .
Author Blenner MA, Dong X and Springer TA.
Journal J. Biol. Chem. 289 (9), 5565-5579 (2014)
Title Carboxyl terminus of ADAMTS13 directly inhibits platelet aggregation and ultra large von Willebrand factor string formation under flow in a free-thiol-dependent manner .
Author Bao J, Xiao J, Mao Y and Zheng XL.
Journal Arterioscler. Thromb. Vasc. Biol. 34 (2), 397-407 (2014)
Title [Markers of endothelial dysfunction (VCAM-1 and vWF) in chronic hepatitis C] .
Author Antonova,T.V., Romanova,M.A. and Lymar',Iu.V.
Journal Ter. Arkh. 85 (12), 86-89 (2013)
Title von Willebrand Disease .
Author Goodeve,A. and James,P.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title von Willebrand disease type B: a missense mutation selectively abolishes ristocetin-induced von Willebrand factor binding to platelet glycoprotein Ib .
Author Rabinowitz I, Tuley EA, Mancuso DJ, Randi AM, Firkin BG, Howard MA and Sadler JE.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (20), 9846-9849 (1992)
Title Defects in type IIA von Willebrand disease: a cysteine 509 to arginine substitution in the mature von Willebrand factor disrupts a disulphide loop involved in the interaction with platelet glycoprotein Ib-IX .
Author Lavergne JM, De Paillette L, Bahnak BR, Ribba AS, Fressinaud E, Meyer D and Pietu G.
Journal Br. J. Haematol. 82 (1), 66-72 (1992)
Title Type IIB von Willebrand's disease: gene mutations and clinical presentation in nine families from Denmark, Germany and Sweden .
Author Donner M, Kristoffersson AC, Lenk H, Scheibel E, Dahlback B, Nilsson IM and Holmberg L.
Journal Br. J. Haematol. 82 (1), 58-65 (1992)
Title Molecular study of von Willebrand disease: identification of potential mutations in patients with type IIA and type IIB .
Author Pietu G, Ribba AS, de Paillette L, Cherel G, Lavergne JM, Bahnak BR and Meyer D.
Journal Blood Coagul. Fibrinolysis 3 (4), 415-421 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.