• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens von Willebrand factor (VWF), mRNA.


RefSeq Accession Definition Services Price Order
NM_000552 Homo sapiens von Willebrand factor (VWF), mRNA. ORF Sequence Quote
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000552.3, 89191867
Length 8833 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens von Willebrand factor (VWF), mRNA.
Product von Willebrand factor preproprotein
Comment

Summary: The glycoprotein encoded by this gene functions as both an antihemophilic factor carrier and a platelet-vessel wall mediator in the blood coagulation system. It is crucial to the hemostasis process. Mutations in this gene or deficiencies in this protein result in von Willebrand's disease. An unprocessed pseudogene has been found on chromosome 22. [provided by RefSeq, Jul 2008].

RefSeq NP_000543.2
CDS 251..8692
Misc Feature(1)170..172
Misc Feature(2)347..784
Misc Feature(3)914..1123
Misc Feature(4)1133..1294
Misc Feature(5)1298..>1417
Misc Feature(6)1379..1870
Misc Feature(7)1979..>2110
Misc Feature(8)2204..2371
Misc Feature(9)2540..2611
Misc Feature(10)order(2549..2551,2672..2674)
Misc Feature(11)order(2576..2578,2660..2662)
Misc Feature(12)2612..2749
Misc Feature(13)order(2678..2680,2711..2713)
Misc Feature(14)2726..2809
Misc Feature(15)2816..3283
Misc Feature(16)order(2849..2851,3236..3238)
Misc Feature(17)order(2915..2917,3341..3343)
Misc Feature(18)order(2942..2944,3227..3229)
Misc Feature(19)order(2990..2992,3011..3013)
Misc Feature(20)3407..3631
Misc Feature(21)order(3428..3430,3500..3502)
Misc Feature(22)order(3626..3628,3638..3640)
Misc Feature(23)3686..3838
Misc Feature(24)order(3695..3697,3755..3757)
Misc Feature(25)order(3707..3709,3743..3745)
Misc Feature(26)order(3836..3838,3845..3847)
Misc Feature(27)order(4064..4066,4622..4624)
Misc Feature(28)4076..>4414
Misc Feature(29)order(4076..4078,4082..4084,4145..4147,4388..4390,
Misc Feature(30)order(4097..4099,4103..4105,4109..4111,4313..4315,
Misc Feature(31)order(4103..4111,4115..4117,4313..4315)
Misc Feature(32)order(4193..4195,4238..4243,4274..4279)
Misc Feature(33)order(4220..4225,4229..4231,4325..4327,4334..4336,
Misc Feature(34)4739..5194
Misc Feature(35)order(4739..4741,4745..4747,4808..4810,5057..5059,
Misc Feature(36)order(4760..4762,4766..4768,4772..4774,4976..4978)
Misc Feature(37)order(4766..4774,4778..4780,4976..4978)
Misc Feature(38)4793..4795
Misc Feature(39)order(4856..4858,4901..4906,4937..4942)
Misc Feature(40)order(4883..4888,4892..4894,4988..4990,4997..4999,
Misc Feature(41)5063..5065
Misc Feature(42)order(5255..5257,5258..5260)
Misc Feature(43)order(5306..5308,5864..5866)
Misc Feature(44)5318..5797
Misc Feature(45)order(5318..5320,5324..5326,5387..5389,5633..5635,
Misc Feature(46)order(5339..5341,5345..5347,5351..5353,5552..5554,
Misc Feature(47)order(5345..5353,5357..5359,5552..5554)
Misc Feature(48)order(5435..5437,5480..5485,5516..5521)
Misc Feature(49)order(5462..5467,5471..5473,5564..5566,5573..5575,
Misc Feature(50)order(5885..5887,5960..5962)
Misc Feature(51)order(6029..6031,6512..6514)
Misc Feature(52)6062..6553
Misc Feature(53)order(6098..6100,6503..6505)
Misc Feature(54)order(6164..6166,6617..6619)
Misc Feature(55)order(6227..6229,6251..6253)
Misc Feature(56)6656..6850
Misc Feature(57)6857..7012
Misc Feature(58)6896..7033
Misc Feature(59)7028..7216
Misc Feature(60)7541..7732
Misc Feature(61)7769..7777
Misc Feature(62)7994..8182
Misc Feature(63)order(8420..8422,8570..8572)
Misc Feature(64)8429..8680
Misc Feature(65)order(8465..8467,8612..8614)
Misc Feature(66)order(8498..8500,8660..8662)
Misc Feature(67)order(8510..8512,8666..8668)
Misc Feature(68)8561..8563
Misc Feature(69)8567..8569
Misc Feature(70)8681..8683
Exon (1)1..250
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (2)251..305
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (3)306..470
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (4)471..573
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (5)574..782
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (6)783..907
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (7)908..1124
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (8)1125..1247
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (9)1248..1359
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (10)1360..1406
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (11)1407..1543
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (12)1544..1682
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (13)1683..1783
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (14)1784..1979
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (15)1980..2195
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (16)2196..2436
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (17)2437..2531
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (18)2532..2692
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (19)2693..2796
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (20)2797..2935
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (21)2936..3070
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (22)3071..3217
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (23)3218..3358
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (24)3359..3472
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (25)3473..3629
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (26)3630..3788
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (27)3789..3924
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (28)3925..5303
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (29)5304..5420
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (30)5421..5561
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (31)5562..5705
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (32)5706..5870
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (33)5871..5914
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (34)5915..6092
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (35)6093..6313
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (36)6314..6506
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (37)6507..6848
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (38)6849..7048
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (39)7049..7151
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (40)7152..7226
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (41)7227..7331
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (42)7332..7537
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (43)7538..7687
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (44)7688..7798
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (45)7799..7979
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (46)7980..8020
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (47)8021..8137
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (48)8138..8236
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (49)8237..8365
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (50)8366..8405
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (51)8406..8503
Gene:VWF
Gene Synonym:F8VWF; VWD
Exon (52)8504..8833
Gene:VWF
Gene Synonym:F8VWF; VWD
Translation MIPARFAGVLLALALILPGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYL LAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYL ETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTL TSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPL VDPEPFVALCEKTLCECAGGLECACPALLEYARTCAQEGMVLYGWTDHSACSPVCPAGME YRQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVHSGKRYPPG TSLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQD HSFSIVIETVQCADDRDAVCTRSVTVRLPGLHNSLVKLKHGAGVAMDGQDVQLPLLKGDL RIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSG LAEPRVEDFGNAWKLHGDCQDLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVS PLPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVRVAWREPGRCELNCPKGQVYLQ CGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPED IFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADN LRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGE TVKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLVQDYCGS NPGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGR YIILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVD FGNSWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPY LDVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGY ECEWRYNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCE VAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGGLVVPPTDAPVSPTTLYVE DISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVE YHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRI TLLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVL SSVDELEQQRDEIVSYLCDLAPEAPPPTLPPDMAQVTVGPGLLGVSTLGPKRNSMVLDVA FVLEGSDKIGEADFNRSKEFMEEVIQRMDVGQDSIHVTVLQYSYMVTVEYPFSEAQSKGD ILQRVREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQAPNLVYMVTGNPASDEIKRLP GDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRCCSGEGLQIPTL SPAPDCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITT IDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILV TDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTM VTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCD RGLRPSCPNSQSPVKVEETCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQNK EQDLEVILHNGACSPGARQGCMKSIEVKHSALSVELHSDMEVTVNGRLVSVPYVGGNMEV NVYGAIMHEVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRD GTVTTDWKTLVQEWTVQRPGQTCQPILEEQCLVPDSSHCQVLLLPLFAECHKVLAPATFY AICQQDSCHQEQVCEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHC DGNVSSCGDHPSEGCFCPPDKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQI CTCLSGRKVNCTTQPCPTAKAPTCGLCEVARLRQNADQCCPEYECVCDPVSCDLPPVPHC ERGLQPTLTNPGECRPNFTCACRKEECKRVSPPSCPPHRLPTLRKTQCCDEYECACNCVN STVSCPLGYLASTATNDCGCTTTTCLPDKVCVHRSTIYPVGQFWEEGCDVCTCTDMEDAV MGLRVAQCSQKPCEDSCRSGFTYVLHEGECCGRCLPSACEVVTGSPRGDSQSSWKSVGSQ WASPENPCLINECVRVKEEVFIQQRNVSCPQLEVPVCPSGFQLSCKTSACCPSCRCERME ACMLNGTVIGPGKTVMIDVCTTCRCMVQVGVISGFKLECRKTTCNPCPLGYKEENNTGEC CGRCLPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHK CLAEGGKIMKIPGTCCDTCEEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMY SIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(113)-dbSNP:
complement(113)-t, cdbSNP:144257680
complement(127)-g, adbSNP:187439551
complement(271)-dbSNP:
complement(271)-g, adbSNP:144128523
complement(272)-t, cdbSNP:201015235
complement(305)-g, adbSNP:61753983
complement(331)-dbSNP:
complement(331)-g, adbSNP:140419498
complement(346)-t, cdbSNP:146778712
complement(350)-t, g, cdbSNP:61753984
complement(364)-t, cdbSNP:2229443
complement(369)-c, adbSNP:138001833
complement(376)-g, adbSNP:200710351
complement(389)-g, cdbSNP:61753985
complement(397)-c, adbSNP:61753986
complement(411)-g, adbSNP:200901782
complement(412)-c, adbSNP:148741727
complement(421)-c, adbSNP:61753987
complement(439)-t, cdbSNP:144310330
complement(441)-, gdbSNP:62643618
complement(462)-c, adbSNP:62643619
complement(492)-dbSNP:
complement(492)-t, cdbSNP:150011066
complement(503)-t, cdbSNP:62643620
complement(506)-t, cdbSNP:140044866
complement(510)-c, adbSNP:62643621
complement(526..527)-, tdbSNP:61753989
complement(526)-, tdbSNP:61753988
complement(554)-t, cdbSNP:147514785
complement(624..637)-dbSNP:
complement(624..637)-, ggtactacaagctgdbSNP:63749066
complement(625..626)-gt, cdbSNP:267607300
complement(635)-c, adbSNP:61753991
complement(640)-t, cdbSNP:2229444
complement(641)-g, adbSNP:76505074
complement(659)-c, adbSNP:71582882
complement(668)-t, cdbSNP:148218885
complement(671)-t, g, adbSNP:61753992
complement(672)-g, adbSNP:61753993
complement(679)-g, adbSNP:202062122
complement(689)-g, adbSNP:199939434
complement(699)-t, c, adbSNP:61753994
complement(728)-t, gdbSNP:61753995
complement(747)-t, adbSNP:62643622
complement(756)-g, adbSNP:201312416
complement(765)-t, cdbSNP:200764995
complement(774)-g, adbSNP:201368895
complement(796)-dbSNP:
complement(796)-t, cdbSNP:143054357
complement(814)-g, adbSNP:200204308
complement(902)-t, cdbSNP:62643623
complement(916)-dbSNP:
complement(916)-g, adbSNP:62643624
complement(956)-g, adbSNP:140912382
complement(980)-t, cdbSNP:137987854
complement(1038..1061)-, gcgcctgccctgccctcctggagtdbSNP:63749067
complement(1040)-t, cdbSNP:145476045
complement(1046)-g, cdbSNP:201450675
complement(1049)-t, cdbSNP:140388695
complement(1067)-t, cdbSNP:61753997
complement(1073)-t, c, adbSNP:61753998
complement(1120)-t, cdbSNP:150192701
complement(1143..1144)-dbSNP:
complement(1143..1144)-, gdbSNP:267607303
complement(1155)-g, cdbSNP:140911166
complement(1167)-g, cdbSNP:200097381
complement(1175)-c, adbSNP:200615283
complement(1182)-g, adbSNP:201496129
complement(1204)-t, adbSNP:1800387
complement(1220)-t, cdbSNP:61754000
complement(1221)-g, adbSNP:61754001
complement(1224)-c, adbSNP:11837584
complement(1225)-g, adbSNP:199928277
complement(1238..1239)-, adbSNP:267607304
complement(1242)-t, cdbSNP:140004667
complement(1243)-t, gdbSNP:147924974
complement(1287)-dbSNP:
complement(1287)-g, adbSNP:111971143
complement(1300)-g, adbSNP:141009309
1321+a, cdbSNP:61754002
complement(1325)-g, adbSNP:146154234
complement(1327)-g, adbSNP:71582884
complement(1328)-t, cdbSNP:199570108
complement(1343)-t, cdbSNP:61754003
complement(1357)-g, cdbSNP:149640698
complement(1367)-dbSNP:
complement(1367)-t, cdbSNP:62643625
complement(1368)-t, cdbSNP:78516266
complement(1371)-c, adbSNP:201185151
complement(1372..1373)-, gdbSNP:141400724
complement(1381)-t, gdbSNP:62643626
complement(1423)-dbSNP:
complement(1423)-t, adbSNP:1800375
complement(1432)-c, adbSNP:1800376
complement(1462..1463)-, aatcccdbSNP:61754006
complement(1463)-t, cdbSNP:142427503
complement(1472)-t, cdbSNP:201306785
complement(1496)-g, adbSNP:185908682
complement(1497)-t, cdbSNP:137950753
complement(1505)-g, adbSNP:201379649
complement(1530)-t, adbSNP:61754007
complement(1556)-dbSNP:
complement(1556)-g, adbSNP:145443126
complement(1558)-g, adbSNP:141796148
complement(1559..1576)-, gacgctgtgtgcacccgcdbSNP:267607305
complement(1574)-g, adbSNP:148247755
complement(1575)-t, cdbSNP:199665748
complement(1579)-g, adbSNP:142404899
complement(1580)-t, cdbSNP:149116506
complement(1582)-g, adbSNP:112620124
complement(1646)-t, cdbSNP:201345218
complement(1660)-g, adbSNP:111867665
complement(1661)-g, adbSNP:1800377
complement(1691)-dbSNP:
complement(1691)-g, adbSNP:186112213
complement(1700)-g, adbSNP:199771680
complement(1701)-g, adbSNP:1800378
complement(1702)-t, adbSNP:147913451
complement(1713)-g, cdbSNP:144817575
complement(1764)-t, cdbSNP:139830291
complement(1766)-t, cdbSNP:201456647
complement(1769)-t, cdbSNP:189409574
complement(1798)-dbSNP:
complement(1798)-t, cdbSNP:1800379
complement(1801)-t, gdbSNP:142956629
complement(1812)-g, cdbSNP:148591481
complement(1813)-g, adbSNP:145932921
complement(1823)-g, adbSNP:267607306
1833+a, gdbSNP:61754010
complement(1844)-g, cdbSNP:200291678
complement(1846)-g, adbSNP:111240043
complement(1863)-g, adbSNP:139196998
complement(1864)-, gdbSNP:35879738
complement(1864)-g, adbSNP:138268387
complement(1875)-g, cdbSNP:141649383
complement(1876)-g, c, adbSNP:35365059
complement(1898)-g, adbSNP:61754011
complement(1899..1900)-, cdbSNP:34625593
complement(1907..1908)-, tdbSNP:267607307
complement(1959)-g, cdbSNP:61754013
complement(1978)-c, adbSNP:150146744
complement(2003)-dbSNP:
complement(2003)-t, cdbSNP:141777100
complement(2031)-g, cdbSNP:267607308
complement(2044)-t, cdbSNP:35302737
complement(2067)-t, cdbSNP:200586078
complement(2080)-c, adbSNP:61754015
complement(2108)-t, gdbSNP:61754016
complement(2119)-g, cdbSNP:61754017
complement(2123..2124)-, gcgdbSNP:61754018
complement(2134)-t, cdbSNP:34237676
complement(2142)-g, adbSNP:199963222
complement(2172)-t, cdbSNP:61754019
complement(2176)-g, adbSNP:61754666
complement(2180)-t, gdbSNP:61748460
complement(2208)-dbSNP:
complement(2208)-g, adbSNP:11064012
complement(2209)-t, cdbSNP:147033167
complement(2241)-g, adbSNP:202186148
complement(2252)-t, gdbSNP:201886182
complement(2266..2269)-, ctctdbSNP:61748462
complement(2274)-g, adbSNP:200087139
complement(2321)-t, gdbSNP:199623726
complement(2322)-, cdbSNP:267607309
complement(2344)-t, cdbSNP:141590700
complement(2353)-g, adbSNP:78995469
complement(2366)-t, cdbSNP:61748463
complement(2374..2375)-, ctdbSNP:61748464
complement(2386)-g, adbSNP:146468788
complement(2407)-, adbSNP:62643628
complement(2449)-dbSNP:
complement(2449)-g, adbSNP:200848454
complement(2457)-g, adbSNP:149168790
complement(2470)-g, adbSNP:2228317
complement(2482)-g, adbSNP:186850965
complement(2519..2520)-, ctdbSNP:61748465
complement(2528)-t, cdbSNP:61748466
complement(2529)-g, adbSNP:61748467
complement(2532)-dbSNP:
complement(2532)-t, cdbSNP:77853528
complement(2534)-g, adbSNP:267607310
complement(2537)-g, adbSNP:61748469
complement(2545)-t, cdbSNP:150043098
complement(2555)-t, g, adbSNP:143145764
complement(2558)-g, adbSNP:149051646
complement(2562)-g, adbSNP:199588249
complement(2563)-t, gdbSNP:61748470
complement(2582)-t, cdbSNP:146892641
complement(2590)-g, cdbSNP:143904314
complement(2591)-g, adbSNP:189056533
complement(2594)-t, cdbSNP:61748471
complement(2595)-g, adbSNP:61748472
complement(2604)-g, adbSNP:61748473
complement(2608)-g, cdbSNP:201435268
complement(2609)-g, adbSNP:61748474
complement(2612)-t, cdbSNP:61748475
complement(2613)-g, adbSNP:61748476
complement(2615)-g, c, adbSNP:1063856
complement(2622)-t, cdbSNP:61748477
2634+a, gdbSNP:61748478
complement(2635)-t, cdbSNP:1063857
complement(2648)-g, adbSNP:61748479
2661+g, tdbSNP:62643630
complement(2685)-t, cdbSNP:62643631
complement(2685)-, cdbSNP:62643632
complement(2696)-dbSNP:
complement(2696)-t, cdbSNP:121964894
complement(2697)-g, adbSNP:62643634
complement(2701)-t, adbSNP:57950734
complement(2747)-t, cdbSNP:151048762
complement(2760)-t, gdbSNP:75645183
complement(2763)-g, adbSNP:149520234
complement(2765)-, gdbSNP:61748481
complement(2775)-t, adbSNP:138084177
complement(2786)-c, adbSNP:200106723
complement(2790..2791)-, adbSNP:267607311
complement(2805)-dbSNP:
complement(2805)-t, cdbSNP:216321
complement(2810)-t, cdbSNP:61748482
complement(2811)-t, cdbSNP:41276738
complement(2823)-t, gdbSNP:61748484
complement(2824)-g, cdbSNP:184227165
complement(2836)-t, gdbSNP:34510401
complement(2841)-t, cdbSNP:146405753
complement(2860)-g, adbSNP:141982646
complement(2861)-t, cdbSNP:148122508
complement(2876)-g, adbSNP:143762054
complement(2882)-t, adbSNP:148969007
complement(2884)-g, adbSNP:113240752
complement(2885)-g, adbSNP:61748485
complement(2891)-, cdbSNP:61748486
complement(2901)-c, adbSNP:146850658
complement(2904)-g, adbSNP:11064002
complement(2905)-g, adbSNP:143867207
complement(2906)-g, adbSNP:141451322
complement(2924)-t, cdbSNP:201072235
complement(2944)-dbSNP:
complement(2944)-g, adbSNP:201892996
complement(2945)-t, cdbSNP:142135013
complement(2984..2985)-, tdbSNP:61748490
complement(2989)-c, adbSNP:35191786
complement(3020)-t, cdbSNP:61748491
complement(3021)-t, cdbSNP:33978901
complement(3051)-g, adbSNP:142563352
complement(3064)-g, adbSNP:139622018
complement(3065)-t, cdbSNP:147408448
complement(3089)-dbSNP:
complement(3089)-t, cdbSNP:142861582
complement(3130)-g, adbSNP:1800380
complement(3145)-g, cdbSNP:144225315
complement(3149)-t, cdbSNP:149573046
complement(3150)-t, cdbSNP:141087261
complement(3156)-g, adbSNP:202175420
complement(3164)-t, cdbSNP:150418484
complement(3177)-t, cdbSNP:181452677
complement(3186)-g, adbSNP:267607312
complement(3236)-dbSNP:
complement(3236)-t, gdbSNP:61748493
complement(3258)-t, cdbSNP:141477932
complement(3272)-t, cdbSNP:138940478
complement(3322)-, cdbSNP:267607313
complement(3339)-t, cdbSNP:145125264
complement(3342)-t, cdbSNP:141412860
complement(3353)-t, cdbSNP:146648301
complement(3394)-dbSNP:
complement(3394)-g, adbSNP:201874365
complement(3409)-t, gdbSNP:61748496
3428+c, tdbSNP:61748497
complement(3429)-g, adbSNP:267607314
complement(3441)-t, gdbSNP:143024162
complement(3462)-t, gdbSNP:267607315
complement(3482)-dbSNP:
complement(3482)-g, adbSNP:267607316
complement(3490)-g, adbSNP:4021576
complement(3508)-g, adbSNP:112634786
complement(3531)-t, cdbSNP:267607317
complement(3541)-g, adbSNP:149895348
complement(3551)-g, c, adbSNP:202034414
complement(3553)-g, cdbSNP:267607318
complement(3557)-t, gdbSNP:113805591
3570+a, gdbSNP:267607319
complement(3571)-g, adbSNP:199851395
complement(3582)-g, adbSNP:267607320
complement(3609)-g, cdbSNP:267607321
complement(3615)-g, adbSNP:183119284
complement(3629)-g, adbSNP:139579968
complement(3635..3636)-dbSNP:
complement(3635..3636)-, agdbSNP:267607322
complement(3638)-t, g, cdbSNP:267607323
complement(3639)-t, gdbSNP:267607324
complement(3664)-g, adbSNP:4008538
complement(3680)-t, gdbSNP:267607325
complement(3687)-g, adbSNP:267607326
complement(3695)-t, cdbSNP:61748511
complement(3710)-t, cdbSNP:267607327
complement(3715)-g, adbSNP:5748551
complement(3717)-t, cdbSNP:267607328
complement(3720)-t, gdbSNP:267607329
complement(3721)-g, adbSNP:5748550
complement(3736)-t, cdbSNP:5746870
complement(3761)-g, cdbSNP:267607330
complement(3765)-c, adbSNP:5748549
complement(3788)-g, adbSNP:267607332
complement(3797)-dbSNP:
complement(3797)-g, cdbSNP:147818186
complement(3799)-g, cdbSNP:144447692
complement(3808)-c, adbSNP:3741908
complement(3818)-t, cdbSNP:61749364
complement(3829)-g, adbSNP:16933969
complement(3836)-t, cdbSNP:61749365
complement(3864)-t, g, adbSNP:121964895
complement(3923)-t, gdbSNP:267607333
complement(3929)-dbSNP:
complement(3929)-t, cdbSNP:61749366
complement(3936)-t, gdbSNP:61749367
complement(3942)-c, adbSNP:61749368
complement(3952)-t, gdbSNP:61749369
complement(3969)-g, adbSNP:150576611
complement(3970)-t, cdbSNP:141792415
complement(3985)-t, cdbSNP:148499318
complement(3997)-g, adbSNP:200893595
complement(3999)-g, cdbSNP:144691240
complement(4039)-t, cdbSNP:199831474
complement(4045)-g, adbSNP:2228319
complement(4045)-g, adbSNP:112026952
4047+a, c, tdbSNP:61749370
complement(4052)-g, c, adbSNP:61749371
complement(4064..4065)-, atttctactdbSNP:63524160
complement(4064)-t, g, cdbSNP:61749372
complement(4065)-t, g, cdbSNP:63524161
complement(4077)-t, cdbSNP:61749374
complement(4081..4083)-, cctdbSNP:61749375
complement(4085)-t, g, adbSNP:61749376
4095..4096+, tcctgctdbSNP:61749377
complement(4095)-t, gdbSNP:61749378
complement(4103)-t, cdbSNP:61749379
4104+c, tdbSNP:61749380
complement(4113)-t, gdbSNP:267607334
complement(4118)-t, cdbSNP:138900040
complement(4127)-t, cdbSNP:267607335
complement(4137)-t, cdbSNP:61749381
complement(4155)-g, adbSNP:61749382
complement(4160)-g, adbSNP:267607336
complement(4162..4163)-, atgdbSNP:61749383
complement(4166)-t, cdbSNP:61749384
complement(4167)-t, g, adbSNP:61749385
complement(4170)-t, cdbSNP:61749386
complement(4172)-t, cdbSNP:61749387
complement(4173)-g, c, adbSNP:61749388
complement(4175)-g, adbSNP:61749389
complement(4179)-t, cdbSNP:61749390
complement(4181)-t, cdbSNP:267607337
complement(4189)-g, cdbSNP:61749392
complement(4190)-t, g, cdbSNP:61749393
complement(4191)-t, adbSNP:61749394
complement(4193)-t, cdbSNP:61749395
complement(4194)-t, g, adbSNP:61749396
complement(4195)-g, adbSNP:143009893
complement(4196)-g, adbSNP:61749397
complement(4220)-g, adbSNP:61749398
complement(4221)-g, cdbSNP:61749399
complement(4237)-g, cdbSNP:138413641
complement(4260)-t, cdbSNP:61749400
complement(4261)-g, adbSNP:1800381
complement(4263)-g, cdbSNP:61749401
complement(4271)-t, cdbSNP:61749402
complement(4272)-t, g, c, adbSNP:61749403
complement(4274)-t, cdbSNP:61749404
complement(4277)-t, cdbSNP:150923481
complement(4286)-t, cdbSNP:61749405
complement(4300)-t, cdbSNP:143459496
complement(4325)-g, adbSNP:61749407
complement(4329)-t, cdbSNP:267607338
complement(4332)-t, cdbSNP:61749408
complement(4335)-c, adbSNP:61750067
complement(4342..4343)-, acdbSNP:61750068
complement(4352)-t, cdbSNP:199703097
complement(4353)-g, adbSNP:199675425
complement(4355)-t, adbSNP:61750069
complement(4365)-t, gdbSNP:61750070
complement(4370)-t, c, adbSNP:61750071
complement(4371)-t, g, adbSNP:61750072
complement(4380)-g, adbSNP:141211612
complement(4383)-t, cdbSNP:61750073
complement(4385)-t, cdbSNP:61750074
complement(4388)-t, cdbSNP:11063988
complement(4391)-g, adbSNP:216311
complement(4396)-c, adbSNP:140464171
complement(4398)-t, g, cdbSNP:61750075
complement(4417)-t, cdbSNP:201895432
complement(4423..4455)-, acggatgtcccggaactttgtccgctacgtccadbSNP:63749069
complement(4423)-t, cdbSNP:145009516
complement(4431)-g, adbSNP:149950364
complement(4432)-g, adbSNP:139215659
complement(4445)-t, cdbSNP:61750077
complement(4446)-g, adbSNP:1800382
complement(4472..4474)-, aagdbSNP:61750078
complement(4472)-t, gdbSNP:141990425
complement(4488)-t, cdbSNP:61750079
complement(4494)-g, adbSNP:61750080
complement(4497)-t, adbSNP:61750081
complement(4513)-g, cdbSNP:61750082
complement(4523)-t, adbSNP:61750083
complement(4531)-g, adbSNP:140077306
complement(4554)-t, cdbSNP:11063987
complement(4559)-g, adbSNP:61750084
complement(4565)-t, cdbSNP:150077670
complement(4589)-g, cdbSNP:61750085
complement(4618)-g, c, adbSNP:61750086
complement(4623)-g, adbSNP:61750087
complement(4628)-g, cdbSNP:61750088
complement(4632)-t, c, adbSNP:61750089
complement(4634)-g, cdbSNP:61750090
complement(4649)-t, cdbSNP:61750091
4664..4665+, cdbSNP:267607339
complement(4664)-g, cdbSNP:1800383
complement(4664)-g, cdbSNP:80313192
complement(4665..4666)-, gdbSNP:61750093
complement(4673)-t, cdbSNP:61750094
complement(4693)-c, adbSNP:144796763
complement(4703)-, gdbSNP:61750095
complement(4707)-g, adbSNP:149424724
complement(4708)-t, cdbSNP:138966048
complement(4749)-c, adbSNP:61750096
complement(4758)-t, g, c, adbSNP:61750097
complement(4763)-g, cdbSNP:61750098
complement(4764)-g, adbSNP:61750099
complement(4767)-t, cdbSNP:61750100
complement(4768)-t, cdbSNP:146928422
complement(4777)-g, adbSNP:141174823
complement(4791)-t, gdbSNP:61750101
complement(4802)-g, adbSNP:61750102
complement(4820)-, gdbSNP:61750103
complement(4835)-g, cdbSNP:138670575
complement(4854..4862)-, tccacgtcadbSNP:267607340
complement(4866)-t, adbSNP:267607341
complement(4869)-t, cdbSNP:267607342
complement(4876)-g, cdbSNP:267607343
complement(4878)-t, cdbSNP:267607344
complement(4885)-, gdbSNP:267607345
complement(4887..4895)-, tgactgtggdbSNP:267607346
complement(4891)-g, adbSNP:216310
complement(4895)-g, adbSNP:267607347
complement(4901)-t, gdbSNP:186559034
complement(4911)-t, cdbSNP:182250388
complement(4915)-c, adbSNP:1800384
complement(4917)-g, adbSNP:61750110
complement(4935)-t, cdbSNP:61750111
complement(4943)-t, gdbSNP:1800385
complement(4946)-t, cdbSNP:61750112
complement(4953)-t, adbSNP:267607348
complement(4955)-g, adbSNP:61909722
complement(4963)-c, adbSNP:144474530
complement(4966)-g, adbSNP:199604081
complement(4967)-g, adbSNP:267607349
complement(4985)-g, adbSNP:61750113
complement(4988)-g, cdbSNP:61750114
complement(4989)-t, cdbSNP:61750115
complement(4997)-t, cdbSNP:61750116
complement(5001)-g, adbSNP:1800386
complement(5039)-t, g, cdbSNP:61750117
complement(5040)-t, g, adbSNP:61750577
complement(5050)-t, cdbSNP:201264909
complement(5058)-t, cdbSNP:267607350
complement(5060)-t, gdbSNP:61750578
complement(5070)-t, adbSNP:61750579
complement(5074)-g, adbSNP:142635883
complement(5075)-g, adbSNP:61750580
complement(5087)-t, cdbSNP:61750581
complement(5091)-g, adbSNP:61750582
complement(5130)-c, adbSNP:61750583
complement(5133)-t, cdbSNP:61750584
complement(5135)-g, adbSNP:61750585
complement(5136)-, gdbSNP:61750586
complement(5139)-t, adbSNP:61750587
complement(5155)-g, adbSNP:148901164
complement(5156)-t, cdbSNP:145676400
complement(5162)-g, adbSNP:61750588
complement(5166)-t, cdbSNP:61750589
complement(5167)-t, cdbSNP:146596289
complement(5173)-t, cdbSNP:140001946
complement(5176)-g, adbSNP:200147615
complement(5192)-t, cdbSNP:61750590
complement(5193)-g, cdbSNP:267607351
complement(5194)-, tdbSNP:61750591
complement(5194)-g, adbSNP:201825372
complement(5218)-t, cdbSNP:143838793
complement(5219)-c, adbSNP:61750592
complement(5220)-t, adbSNP:61750593
complement(5221..5222)-, cdbSNP:61750594
complement(5225)-t, cdbSNP:61750595
complement(5244)-t, adbSNP:61750596
complement(5254)-t, gdbSNP:61750597
complement(5264)-g, adbSNP:61750598
complement(5273..5274)-ct, tadbSNP:61750599
complement(5299)-t, gdbSNP:79275181
complement(5299)-t, gdbSNP:200368994
complement(5315)-dbSNP:
complement(5315)-t, gdbSNP:139320345
complement(5389)-g, adbSNP:150873446
complement(5406)-t, gdbSNP:74509284
complement(5414)-t, cdbSNP:141543274
complement(5423)-dbSNP:
complement(5423)-g, adbSNP:78302129
complement(5427)-c, adbSNP:147313320
complement(5430..5431)-, ttdbSNP:61750602
complement(5441)-t, adbSNP:61750603
complement(5485)-t, gdbSNP:267607352
complement(5527)-g, adbSNP:41276736
complement(5528)-g, adbSNP:61750604
complement(5535)-t, cdbSNP:199729586
complement(5563)-dbSNP:
complement(5563)-t, gdbSNP:2229448
complement(5571)-t, cdbSNP:61750605
complement(5582)-g, cdbSNP:138004269
complement(5585)-t, cdbSNP:61750606
complement(5597)-t, gdbSNP:267607353
complement(5604)-g, adbSNP:150349730
complement(5606)-g, cdbSNP:267607354
complement(5620)-t, cdbSNP:71582868
complement(5630)-g, adbSNP:267607355
complement(5634)-g, adbSNP:146729537
complement(5703)-g, adbSNP:61750608
complement(5715)-dbSNP:
complement(5715)-t, gdbSNP:61750609
complement(5721)-c, adbSNP:61750610
complement(5736)-t, cdbSNP:143445274
complement(5742)-t, cdbSNP:186798928
complement(5765)-g, adbSNP:141134620
complement(5783)-t, cdbSNP:201548925
complement(5791)-g, adbSNP:146540001
complement(5795)-g, adbSNP:61750611
complement(5807)-t, cdbSNP:61750612
complement(5813)-t, cdbSNP:139711566
complement(5850)-g, adbSNP:200461577
complement(5881)-dbSNP:
complement(5881)-t, cdbSNP:144221902
complement(5917)-dbSNP:
complement(5917)-g, adbSNP:56981471
complement(5954)-t, cdbSNP:144757652
complement(6035)-t, adbSNP:149799233
complement(6051)-c, adbSNP:139845585
complement(6094)-dbSNP:
complement(6094)-g, adbSNP:216902
complement(6101)-t, cdbSNP:144072210
complement(6104)-t, cdbSNP:113237579
complement(6140)-c, adbSNP:267607356
complement(6191)-t, gdbSNP:61750613
complement(6215)-g, cdbSNP:199924971
complement(6229)-g, adbSNP:200642838
complement(6266)-t, cdbSNP:140229844
complement(6289)-g, adbSNP:200034511
complement(6302)-t, cdbSNP:185374140
complement(6349)-dbSNP:
complement(6349)-g, adbSNP:55784921
complement(6354)-t, cdbSNP:186806674
complement(6372)-t, cdbSNP:141949957
complement(6376)-g, adbSNP:201819291
complement(6388)-g, cdbSNP:183640579
complement(6432)-, tdbSNP:61750614
complement(6437)-t, cdbSNP:61750615
complement(6469)-g, adbSNP:147982896
complement(6497)-t, cdbSNP:143478216
complement(6500)-g, cdbSNP:192374602
complement(6505)-g, adbSNP:201189728
complement(6527)-dbSNP:
complement(6527)-g, cdbSNP:149274687
complement(6531)-t, cdbSNP:199546602
complement(6553)-t, gdbSNP:115914543
complement(6561)-t, cdbSNP:61750616
complement(6595)-t, adbSNP:11537642
complement(6602)-g, adbSNP:200719767
complement(6616)-t, cdbSNP:141097321
complement(6627)-g, adbSNP:71579338
complement(6635)-t, gdbSNP:61750617
complement(6655)-g, cdbSNP:146529302
complement(6674)-g, adbSNP:190741083
complement(6683)-t, cdbSNP:61750618
complement(6723)-g, adbSNP:201394479
complement(6770)-t, gdbSNP:61750619
complement(6782)-t, gdbSNP:34230288
complement(6786)-t, cdbSNP:61750620
complement(6804)-g, adbSNP:2229446
complement(6811)-g, adbSNP:151250563
complement(6870)-dbSNP:
complement(6870)-t, cdbSNP:61750622
complement(6890)-g, adbSNP:201195374
complement(6902)-g, adbSNP:200382972
complement(6916)-t, gdbSNP:199831766
complement(6919)-g, adbSNP:149847513
complement(6924)-t, cdbSNP:142316574
complement(6927)-t, gdbSNP:181987927
complement(6947)-g, cdbSNP:61750623
complement(6988)-g, adbSNP:61731159
complement(7006)-t, cdbSNP:71581020
complement(7018)-g, cdbSNP:200300292
complement(7019)-t, adbSNP:62643638
complement(7034)-t, cdbSNP:147715696
complement(7093)-dbSNP:
complement(7093)-t, gdbSNP:5020485
complement(7096)-g, adbSNP:1053523
complement(7109)-t, cdbSNP:61750625
complement(7128)-g, adbSNP:142921275
complement(7140)-g, adbSNP:201372397
complement(7144)-t, cdbSNP:147523582
complement(7158)-dbSNP:
complement(7158)-g, adbSNP:149432685
complement(7161)-g, adbSNP:61750626
complement(7166)-g, adbSNP:138997660
complement(7168)-g, cdbSNP:144777030
complement(7181)-g, adbSNP:150725355
complement(7182)-g, adbSNP:267607357
complement(7187)-g, adbSNP:184921605
complement(7188)-g, adbSNP:62641242
complement(7199)-t, cdbSNP:138618444
complement(7215)-t, adbSNP:201792015
complement(7257)-dbSNP:
complement(7257)-g, adbSNP:144769404
complement(7268)-t, cdbSNP:61750628
complement(7274)-g, adbSNP:142612858
complement(7275)-g, adbSNP:34120165
complement(7278)-t, gdbSNP:61750629
complement(7309)-g, cdbSNP:112319661
complement(7330)-g, adbSNP:111597150
7335+dbSNP:
7335+g, tdbSNP:61750630
complement(7367)-g, adbSNP:148908677
complement(7375..7376)-, cdbSNP:267607359
complement(7380..7381)-, cdbSNP:267607360
complement(7385)-t, cdbSNP:61751283
complement(7387..7388)-, tdbSNP:267607361
complement(7400)-g, adbSNP:145697622
complement(7401)-t, cdbSNP:150201871
complement(7424)-g, adbSNP:181290699
complement(7426)-t, gdbSNP:61751285
complement(7441)-g, adbSNP:142422347
complement(7457)-t, cdbSNP:147705313
complement(7470)-g, adbSNP:201494706
complement(7486)-t, gdbSNP:145450160
complement(7489)-g, adbSNP:216867
complement(7531)-g, adbSNP:151303589
complement(7544..7545)-dbSNP:
complement(7544..7545)-, gtdbSNP:62643639
complement(7550)-t, g, cdbSNP:62643640
complement(7571)-t, gdbSNP:62643641
complement(7576)-c, adbSNP:139290955
complement(7579)-g, adbSNP:142444263
complement(7594)-g, adbSNP:55944252
complement(7611)-t, gdbSNP:200486416
complement(7612)-g, adbSNP:146504585
complement(7627)-g, adbSNP:142452106
complement(7628)-t, cdbSNP:149677556
complement(7640)-t, cdbSNP:61751286
complement(7642)-g, adbSNP:149984396
7643..7644+, cgtgatgggcctccgcgdbSNP:267607362
complement(7655)-t, cdbSNP:61751287
complement(7658)-t, cdbSNP:61751288
complement(7680)-g, c, adbSNP:61751289
complement(7683)-t, cdbSNP:111752224
complement(7687)-g, adbSNP:267607363
complement(7699..7700)-dbSNP:
complement(7699..7700)-, adbSNP:61751291
complement(7700)-t, cdbSNP:139864572
complement(7739)-t, cdbSNP:61751292
complement(7767)-g, adbSNP:181094101
complement(7801)-dbSNP:
complement(7801)-g, adbSNP:145955543
complement(7802)-g, adbSNP:61751293
complement(7809)-c, adbSNP:61751294
complement(7849)-t, adbSNP:61751295
complement(7853)-t, cdbSNP:61751296
complement(7854)-t, cdbSNP:137987906
complement(7869)-g, adbSNP:150778949
complement(7875)-t, adbSNP:201213029
complement(7880)-t, cdbSNP:61751297
complement(7886)-t, adbSNP:61751298
complement(7914..7915)-, agdbSNP:267607364
complement(7922)-g, adbSNP:202068340
complement(7924..7925)-, cdbSNP:267607365
complement(7932)-t, adbSNP:35335161
complement(7933)-, tdbSNP:61751300
complement(7948)-g, adbSNP:16932285
complement(7957)-t, cdbSNP:143235468
complement(7969)-t, gdbSNP:192262780
complement(8024)-dbSNP:
complement(8024)-t, cdbSNP:142316324
complement(8050)-g, adbSNP:200209213
complement(8052)-g, adbSNP:138303680
complement(8061)-t, cdbSNP:147052620
complement(8083)-g, adbSNP:111619561
complement(8126)-t, gdbSNP:141666705
complement(8136)-t, c, adbSNP:112100565
complement(8155)-dbSNP:
complement(8155)-g, adbSNP:201953086
complement(8190)-t, cdbSNP:61751302
complement(8196)-c, adbSNP:202052078
complement(8231)-g, adbSNP:199968654
complement(8238)-dbSNP:
complement(8238)-g, cdbSNP:149834874
complement(8247)-g, adbSNP:78353028
complement(8248)-t, cdbSNP:201890452
complement(8262)-g, adbSNP:61751303
complement(8286)-t, cdbSNP:151129435
complement(8298)-t, cdbSNP:144511926
complement(8318)-c, adbSNP:200389567
complement(8328)-g, adbSNP:62641243
complement(8329)-g, adbSNP:41276732
complement(8334)-g, cdbSNP:76459136
complement(8344)-t, cdbSNP:144030544
complement(8363)-t, cdbSNP:7962217
complement(8414)-dbSNP:
complement(8414)-g, cdbSNP:62641244
complement(8432)-t, adbSNP:199871749
complement(8437..8444)-, caggctgcdbSNP:267607367
complement(8466)-g, adbSNP:61751305
complement(8491..8499)-, ccactactgdbSNP:267607368
complement(8512)-dbSNP:
complement(8512)-t, gdbSNP:61751306
complement(8523)-g, adbSNP:144542595
complement(8539)-g, adbSNP:149309674
complement(8561)-t, adbSNP:61751307
complement(8562)-g, adbSNP:61751308
complement(8566)-, cdbSNP:61751309
complement(8567)-t, cdbSNP:61751310
complement(8568)-g, cdbSNP:61751311
complement(8575)-g, adbSNP:138588762
complement(8577)-t, cdbSNP:61751312
complement(8583)-t, cdbSNP:150577615
complement(8587)-t, cdbSNP:201741225
complement(8591)-t, cdbSNP:61751313
complement(8628)-g, adbSNP:143743709
complement(8632)-t, gdbSNP:3087517
complement(8652)-c, adbSNP:267607369
complement(8661)-g, adbSNP:267607370
complement(8662..8663)-, tccccdbSNP:267607371
complement(8666)-t, cdbSNP:267607372
complement(8689)-t, cdbSNP:138263930
Gene SymbolVWF
Gene SynonymF8VWF; VWD
Chromosome12
Locus Map12p13.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000552 Homo sapiens von Willebrand factor (VWF), mRNA. Full Length Quote
ORF Sequence Quote
Title Linkage analysis identifies a locus for plasma von Willebrand factor undetected by genome-wide association .
Author Desch,K.C., Ozel,A.B., Siemieniak,D., Kalish,Y., Shavit,J.A., Thornburg,C.D., Sharathkumar,A.A., McHugh,C.P., Laurie,C.C., Crenshaw,A., Mirel,D.B., Kim,Y., Cropp,C.D., Molloy,A.M., Kirke,P.N., Bailey-Wilson,J.E., Wilson,A.F., Mills,J.L., Scott,J.M., Brody,L.C., Li,J.Z. and Ginsburg,D.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (2), 588-593 (2013)
Title Distinct roles of Ser-764 and Lys-773 at the N terminus of von Willebrand factor in complex assembly with coagulation factor VIII .
Author Castro-Nunez,L., Bloem,E., Boon-Spijker,M.G., van der Zwaan,C., van den Biggelaar,M., Mertens,K. and Meijer,A.B.
Journal J. Biol. Chem. 288 (1), 393-400 (2013)
Title Direct observation of von Willebrand factor elongation and fiber formation on collagen during acute whole blood exposure to pathological flow .
Author Colace,T.V. and Diamond,S.L.
Journal Arterioscler. Thromb. Vasc. Biol. 33 (1), 105-113 (2013)
Title Association between variations in coagulation system genes and carotid plaque .
Author Della-Morte,D., Beecham,A., Dong,C., Wang,L., McClendon,M.S., Gardener,H., Blanton,S.H., Sacco,R.L. and Rundek,T.
Journal J. Neurol. Sci. 323 (1-2), 93-98 (2012)
Title PR3 and elastase alter PAR1 signaling and trigger vWF release via a calcium-independent mechanism from glomerular endothelial cells .
Author Tull,S.P., Bevins,A., Kuravi,S.J., Satchell,S.C., Al-Ani,B., Young,S.P., Harper,L., Williams,J.M., Rainger,G.E. and Savage,C.O.
Journal PLoS ONE 7 (8), E43916 (2012)
Title Characterization of recombinant von Willebrand factor corresponding to mutations in type IIA and type IIB von Willebrand disease .
Author Ribba,A.S., Voorberg,J., Meyer,D., Pannekoek,H. and Pietu,G.
Journal J. Biol. Chem. 267 (32), 23209-23215 (1992)
Title von Willebrand disease type B: a missense mutation selectively abolishes ristocetin-induced von Willebrand factor binding to platelet glycoprotein Ib .
Author Rabinowitz,I., Tuley,E.A., Mancuso,D.J., Randi,A.M., Firkin,B.G., Howard,M.A. and Sadler,J.E.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (20), 9846-9849 (1992)
Title Defects in type IIA von Willebrand disease: a cysteine 509 to arginine substitution in the mature von Willebrand factor disrupts a disulphide loop involved in the interaction with platelet glycoprotein Ib-IX .
Author Lavergne,J.M., De Paillette,L., Bahnak,B.R., Ribba,A.S., Fressinaud,E., Meyer,D. and Pietu,G.
Journal Br. J. Haematol. 82 (1), 66-72 (1992)
Title Type IIB von Willebrand's disease: gene mutations and clinical presentation in nine families from Denmark, Germany and Sweden .
Author Donner,M., Kristoffersson,A.C., Lenk,H., Scheibel,E., Dahlback,B., Nilsson,I.M. and Holmberg,L.
Journal Br. J. Haematol. 82 (1), 58-65 (1992)
Title Molecular study of von Willebrand disease: identification of potential mutations in patients with type IIA and type IIB .
Author Pietu,G., Ribba,A.S., de Paillette,L., Cherel,G., Lavergne,J.M., Bahnak,B.R. and Meyer,D.
Journal Blood Coagul. Fibrinolysis 3 (4), 415-421 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878