• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens Werner syndrome, RecQ helicase-like (WRN), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000553 Homo sapiens Werner syndrome, RecQ helicase-like (WRN), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_000553.4, 182507163
Length 5765 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens Werner syndrome, RecQ helicase-like (WRN), mRNA.
Product Werner syndrome ATP-dependent helicase
Comment

Summary: This gene encodes a member of the RecQ subfamily and the DEAH (Asp-Glu-Ala-His) subfamily of DNA and RNA helicases. DNA helicases are involved in many aspects of DNA metabolism, including transcription, replication, recombination, and repair. This protein contains a nuclear localization signal in the C-terminus and shows a predominant nucleolar localization. It possesses an intrinsic 3' to 5' DNA helicase activity, and is also a 3' to 5' exonuclease. Based on interactions between this protein and Ku70/80 heterodimer in DNA end processing, this protein may be involved in the repair of double strand DNA breaks. Defects in this gene are the cause of Werner syndrome, an autosomal recessive disorder characterized by premature aging. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data.

RefSeq NP_000544.2
CDS 789..5087
Misc Feature(1)774..776
Misc Feature(2)789..1619
Misc Feature(3)789..1619
Misc Feature(4)969..1475
Misc Feature(5)order(1032..1043,1200..1205,1209..1217,1314..1319,
Misc Feature(6)order(1032..1034,1038..1040,1215..1217,1422..1424,
Misc Feature(7)order(1035..1043,1200..1205,1209..1214,1314..1319,
Misc Feature(8)1221..1223
Misc Feature(9)2058..2219
Misc Feature(10)2064..2066
Misc Feature(11)2106..2108
Misc Feature(12)2145..2147
Misc Feature(13)2187..2189
Misc Feature(14)2400..3818
Misc Feature(15)2481..2903
Misc Feature(16)2508..2522
Misc Feature(17)2790..2801
Misc Feature(18)2790..2801
Misc Feature(19)3060..3389
Misc Feature(20)order(3102..3113,3171..3176,3249..3257)
Misc Feature(21)order(3273..3275,3336..3338,3348..3350,3357..3359)
Misc Feature(22)3660..3941
Misc Feature(23)3747..3767
Misc Feature(24)3897..3899
Misc Feature(25)3960..3962
Misc Feature(26)4185..4187
Misc Feature(27)4209..4211
Misc Feature(28)4254..4475
Misc Feature(29)4662..4664
Exon (1)1..712
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (2)713..884
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (3)885..997
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (4)998..1143
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (5)1144..1292
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (6)1293..1442
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (7)1443..1512
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (8)1513..1627
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (9)1628..2057
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (10)2058..2138
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (11)2139..2219
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (12)2220..2364
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (13)2365..2440
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (14)2441..2508
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (15)2509..2617
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (16)2618..2686
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (17)2687..2769
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (18)2770..2876
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (19)2877..3061
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (20)3062..3236
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (21)3237..3418
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (22)3419..3520
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (23)3521..3613
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (24)3614..3755
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (25)3756..3926
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (26)3927..4021
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (27)4022..4097
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (28)4098..4171
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (29)4172..4247
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (30)4248..4360
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (31)4361..4475
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (32)4476..4607
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (33)4608..4770
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (34)4771..4979
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Exon (35)4980..5746
Gene:WRN
Gene Synonym:RECQ3; RECQL2; RECQL3
Translation MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVYSYDAS DCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVF PQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSL VKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILDDTVQRFAIN KEEEILLSDMNKQLTSISEEVMDLAKHLPHAFSKLENPRRVSILLKDISENLYSLRRMII GSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPTLDHLAKHDGE DVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYK STEHLSPNDNENDTSYVIESDEDLEMEMLKHLSPNDNENDTSYVIESDEDLEMEMLKSLE NLNSGTVEPTHSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCL KMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLIS LMEDQVLQLKMSNIPACFLGSAQSENVLTDIKLGKYRIVYVTPEYCSGNMGLLQQLEADI GITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIVALTATASSSIREDIVRCLNL RNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTQQV TGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYG APKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKME KYLHSSRCRRQIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFG PQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSR QLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQSLILQANEELCPKKLLLPSSK TVSSGTKEHCYNQVPVELSTEKKSNLEKLYSYKPCDKISSGSNISKKSIMVQSPEKAYSS SQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKR IDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMA ITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVI RNPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEE ICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
158+dbSNP:
158+c, gdbSNP:10112017
171+c, gdbSNP:7017069
184+a, cdbSNP:11574155
381+c, tdbSNP:11574156
511+c, gdbSNP:11574157
514+, gdbSNP:5890546
576+a, gdbSNP:11574158
592+c, tdbSNP:11574159
626+c, gdbSNP:11574160
705+c, tdbSNP:188087758
738+dbSNP:
738+c, tdbSNP:187869929
741+c, tdbSNP:193031348
804+c, tdbSNP:202148988
830+a, gdbSNP:3087420
863+a, gdbSNP:150524008
883+c, tdbSNP:34477820
894+dbSNP:
894+c, tdbSNP:141495269
895+c, tdbSNP:34084741
902+c, tdbSNP:201800431
910+, adbSNP:11309545
917+c, tdbSNP:201590676
918+c, gdbSNP:139775895
932+a, gdbSNP:145959045
1017+dbSNP:
1017+c, gdbSNP:144670883
1058+c, tdbSNP:148758902
1114+a, gdbSNP:142346721
1128+a, gdbSNP:2230009
1161+dbSNP:
1161+a, gdbSNP:267607007
1191+a, gdbSNP:267607008
1194+a, gdbSNP:17847582
1224+a, gdbSNP:141559844
1234+a, gdbSNP:61761625
1240+a, tdbSNP:200456571
1273+c, tdbSNP:147661728
1274+a, gdbSNP:141480904
1301+dbSNP:
1301+c, tdbSNP:1800389
1398+c, tdbSNP:199644081
1416+a, cdbSNP:138037385
1452+dbSNP:
1452+a, tdbSNP:201902936
1462+a, gdbSNP:62506077
1464+a, cdbSNP:143088402
1508+g, tdbSNP:148229804
1526+dbSNP:
1526+a, cdbSNP:141615988
1623+c, tdbSNP:199923241
1625+c, gdbSNP:113672137
1635+dbSNP:
1635+a, gdbSNP:201643901
1640+a, gdbSNP:146197312
1758+a, gdbSNP:1800390
1765+a, gdbSNP:143068173
1772+a, gdbSNP:201979783
1774+a, gdbSNP:4987237
1813+c, tdbSNP:181033722
1815+a, gdbSNP:11574222
1893+c, tdbSNP:17847577
1937+g, tdbSNP:4987238
1943+a, gdbSNP:2230010
1949+a, gdbSNP:1800391
1960+g, tdbSNP:145445994
1968+c, tdbSNP:75632545
1969+c, tdbSNP:200487813
1970+a, gdbSNP:138565529
2112+dbSNP:
2112+a, gdbSNP:147669987
2129+a, gdbSNP:200380997
2212+dbSNP:
2212+c, tdbSNP:140666473
2293+dbSNP:
2293+g, tdbSNP:201172985
2317+a, gdbSNP:113811718
2318+a, tdbSNP:149565907
2386+dbSNP:
2386+a, gdbSNP:11574240
2416+a, cdbSNP:151001436
2492+dbSNP:
2492+c, tdbSNP:140875989
2505+a, gdbSNP:150148567
2507+g, tdbSNP:145564947
2513+dbSNP:
2513+c, tdbSNP:13438802
2518+a, tdbSNP:121908448
2548+a, tdbSNP:137977751
2576+c, tdbSNP:13438803
2594+c, gdbSNP:201586173
2623+dbSNP:
2623+c, gdbSNP:11574250
2670+c, gdbSNP:77969734
2697+dbSNP:
2697+c, tdbSNP:148286708
2705+a, gdbSNP:200291937
2741+c, tdbSNP:11574263
2777+dbSNP:
2777+a, gdbSNP:201982706
2840+c, tdbSNP:148385320
2847+g, tdbSNP:185468906
2855+c, tdbSNP:191757062
2896+dbSNP:
2896+c, gdbSNP:201384942
2902+c, tdbSNP:141563618
2907+a, cdbSNP:150890415
2911+c, tdbSNP:11574289
2916+a, gdbSNP:180814740
2919+c, tdbSNP:34560788
2934+c, tdbSNP:201990558
2953+a, gdbSNP:186693124
2967..2968+, tdbSNP:281865158
2982+c, tdbSNP:143916053
3029+g, tdbSNP:2230011
3069+dbSNP:
3069+c, tdbSNP:200009031
3088+c, gdbSNP:201282577
3103+c, tdbSNP:140730934
3130+c, tdbSNP:17847568
3149+g, tdbSNP:1800392
3159+g, tdbSNP:200169079
3199+a, gdbSNP:145698720
3204+a, gdbSNP:200935416
3227+a, tdbSNP:182891206
3248+dbSNP:
3248+g, tdbSNP:1800393
3288+c, tdbSNP:3087425
3289+a, gdbSNP:201442356
3357+c, tdbSNP:201188293
3359+c, tdbSNP:3087432
3383+c, tdbSNP:140176367
3397+c, tdbSNP:188554751
3398+c, tdbSNP:199976474
3429+dbSNP:
3429+a, cdbSNP:201958640
3437+a, gdbSNP:201806650
3523+dbSNP:
3523+g, tdbSNP:11574323
3539+a, tdbSNP:201406649
3566+a, cdbSNP:142216807
3632+dbSNP:
3632+c, tdbSNP:151267769
3674+a, gdbSNP:146727423
3725+g, tdbSNP:147802438
3734+a, gdbSNP:145367571
3738+a, tdbSNP:146443310
3771+dbSNP:
3771+a, gdbSNP:140768346
3773+c, tdbSNP:150095039
3774+a, gdbSNP:138379977
3812+a, gdbSNP:184758404
3846+c, tdbSNP:190364546
3847+a, gdbSNP:115298665
3876+a, gdbSNP:143793363
3879+c, gdbSNP:138492730
3885+c, tdbSNP:143954702
3889+a, tdbSNP:200370409
3903+a, gdbSNP:113001550
3950+dbSNP:
3950+c, tdbSNP:111426441
3961+c, tdbSNP:147294573
3997+g, tdbSNP:61761622
3999+c, tdbSNP:61761623
4010+g, tdbSNP:1801195
4024+dbSNP:
4024+c, tdbSNP:3087414
4025+a, gdbSNP:11574345
4111+dbSNP:
4111+a, cdbSNP:201274303
4123+a, gdbSNP:113532342
4183+dbSNP:
4183+a, gdbSNP:146265072
4185+g, tdbSNP:11574358
4210+c, tdbSNP:139323683
4241+a, gdbSNP:144116311
4243+a, cdbSNP:200240557
4259+dbSNP:
4259+c, tdbSNP:146480453
4281+c, tdbSNP:121908447
4288+a, gdbSNP:149071983
4309+c, tdbSNP:182077287
4316+c, tdbSNP:142109468
4361+dbSNP:
4361+a, gdbSNP:200018117
4376+a, gdbSNP:61761624
4378+, adbSNP:281865160
4379+c, tdbSNP:151143960
4380+a, gdbSNP:147116477
4453+g, tdbSNP:17847574
4495+dbSNP:
4495+c, tdbSNP:140064662
4526+a, gdbSNP:147117969
4566+a, gdbSNP:201107091
4569+a, gdbSNP:201661079
4573+c, gdbSNP:78488552
4618+dbSNP:
4618+c, gdbSNP:199849137
4663+a, cdbSNP:142614369
4669+c, tdbSNP:146861737
4681+g, tdbSNP:202129203
4688+a, cdbSNP:138886038
4701+c, tdbSNP:121908446
4778+dbSNP:
4778+g, tdbSNP:11547230
4789+g, tdbSNP:200403732
4803+a, gdbSNP:11574395
4871+c, tdbSNP:1801196
4887+c, tdbSNP:1346044
4888+a, gdbSNP:141823548
4889+c, tdbSNP:201955394
4911+c, tdbSNP:112224806
4915+c, tdbSNP:146055899
4966+g, tdbSNP:186424616
5004+dbSNP:
5004+c, tdbSNP:11574410
5036+c, tdbSNP:112024742
5062+c, tdbSNP:143771120
5068+c, gdbSNP:61751045
5281+c, tdbSNP:11574411
5399+a, gdbSNP:189143230
5458+a, gdbSNP:147191291
5502+c, gdbSNP:11574412
5598+c, tdbSNP:11574413
5630+c, gdbSNP:11574414
5657+a, gdbSNP:11574415
5661+c, tdbSNP:11574416
5691+a, gdbSNP:11574417
Gene SymbolWRN
Gene SynonymRECQ3; RECQL2; RECQL3
Chromosome8
Locus Map8p12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000553 Homo sapiens Werner syndrome, RecQ helicase-like (WRN), mRNA. On-demand TBD TBD
Title Copy number variations of DNA repair genes and the age-related cataract: Jiangsu Eye Study .
Author Jiang,J., Zhou,J., Yao,Y., Zhu,R., Liang,C., Jiang,S., Yang,M., Lu,Y., Xing,Q. and Guan,H.
Journal Invest. Ophthalmol. Vis. Sci. 54 (2), 932-938 (2013)
Title The associations between single nucleotide polymorphisms of DNA repair genes, DNA damage, and age-related cataract: Jiangsu Eye Study .
Author Su,S., Yao,Y., Zhu,R., Liang,C., Jiang,S., Hu,N., Zhou,J., Yang,M., Xing,Q. and Guan,H.
Journal Invest. Ophthalmol. Vis. Sci. 54 (2), 1201-1207 (2013)
Title Enhancement of human DNA polymerase eta activity and fidelity is dependent upon a bipartite interaction with the Werner syndrome protein .
Author Maddukuri,L., Ketkar,A., Eddy,S., Zafar,M.K., Griffin,W.C. and Eoff,R.L.
Journal J. Biol. Chem. 287 (50), 42312-42323 (2012)
Title The roles of WRN and BLM RecQ helicases in the Alternative Lengthening of Telomeres .
Author Mendez-Bermudez,A., Hidalgo-Bravo,A., Cotton,V.E., Gravani,A., Jeyapalan,J.N. and Royle,N.J.
Journal Nucleic Acids Res. 40 (21), 10809-10820 (2012)
Title Werner syndrome protein suppresses the formation of large deletions during the replication of human telomeric sequences .
Author Damerla,R.R., Knickelbein,K.E., Strutt,S., Liu,F.J., Wang,H. and Opresko,P.L.
Journal Cell Cycle 11 (16), 3036-3044 (2012)
Title The Werner syndrome protein is a DNA helicase .
Author Gray,M.D., Shen,J.C., Kamath-Loeb,A.S., Blank,A., Sopher,B.L., Martin,G.M., Oshima,J. and Loeb,L.A.
Journal Nat. Genet. 17 (1), 100-103 (1997)
Title Mutation and haplotype analyses of the Werner's syndrome gene based on its genomic structure: genetic epidemiology in the Japanese population .
Author Matsumoto,T., Imamura,O., Yamabe,Y., Kuromitsu,J., Tokutake,Y., Shimamoto,A., Suzuki,N., Satoh,M., Kitao,S., Ichikawa,K., Kataoka,H., Sugawara,K., Thomas,W., Mason,B., Tsuchihashi,Z., Drayna,D., Sugawara,M., Sugimoto,M., Furuichi,Y. and Goto,M.
Journal Hum. Genet. 100 (1), 123-130 (1997)
Title Association of a polymorphic variant of the Werner helicase gene with myocardial infarction in a Japanese population .
Author Ye,L., Miki,T., Nakura,J., Oshima,J., Kamino,K., Rakugi,H., Ikegami,H., Higaki,J., Edland,S.D., Martin,G.M. and Ogihara,T.
Journal Am. J. Med. Genet. 68 (4), 494-498 (1997)
Title Positional cloning of the Werner's syndrome gene .
Author Yu,C.E., Oshima,J., Fu,Y.H., Wijsman,E.M., Hisama,F., Alisch,R., Matthews,S., Nakura,J., Miki,T., Ouais,S., Martin,G.M., Mulligan,J. and Schellenberg,G.D.
Journal Science 272 (5259), 258-262 (1996)
Title Genetic linkage of Werner's syndrome to five markers on chromosome 8 .
Author Goto,M., Rubenstein,M., Weber,J., Woods,K. and Drayna,D.
Journal Nature 355 (6362), 735-738 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.