• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 1, beta (IL1B), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25334 Homo sapiens interleukin 1, beta (IL1B), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu25334C Homo sapiens interleukin 1, beta (IL1B), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000576.2, 27894305
Length 810 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 1, beta (IL1B), mRNA.
Product interleukin-1 beta proprotein
Comment

Summary: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2008].

RefSeq NP_000567.1
CDS 88..897
Misc Feature(1)88..396
Misc Feature(2)88..396
Misc Feature(3)166..168
Misc Feature(4)166..168
Misc Feature(5)433..435
Misc Feature(6)433..435
Misc Feature(7)445..447
Misc Feature(8)454..882
Misc Feature(9)order(460..462,466..468,868..870)
Misc Feature(10)order(475..480,508..510,514..516,523..525,529..531,
Misc Feature(11)508..510
Exon (1)1..72
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Exon (2)73..134
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Exon (3)135..186
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Exon (4)187..388
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Exon (5)389..553
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Exon (6)554..684
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Exon (7)685..1498
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Translation MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTKGGQDITDFTMQFVSS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
20+dbSNP:
20+a, cdbSNP:1133555
complement(26)-t, adbSNP:115403599
40+g, tdbSNP:1799916
49+c, tdbSNP:1133558
complement(100)-t, gdbSNP:370988408
complement(115)-t, cdbSNP:376289593
complement(119)-g, adbSNP:369312177
complement(135)-dbSNP:
complement(135)-g, adbSNP:137872663
complement(179)-t, adbSNP:200223008
complement(193)-dbSNP:
complement(193)-c, adbSNP:373677368
complement(207)-t, gdbSNP:373127037
complement(211)-t, adbSNP:369824057
complement(225)-g, adbSNP:140794289
complement(226)-t, cdbSNP:140821206
complement(228)-t, gdbSNP:143589371
complement(258)-t, cdbSNP:16062
complement(258)-g, adbSNP:386539628
complement(275)-t, cdbSNP:200278471
complement(281)-g, adbSNP:371093341
complement(321)-t, cdbSNP:62157449
complement(341)-c, adbSNP:376341819
complement(351)-g, adbSNP:373172825
complement(352)-t, cdbSNP:371339015
complement(362)-g, adbSNP:200401035
complement(401)-dbSNP:
complement(401)-g, adbSNP:373103547
402+c, tdbSNP:1143634
complement(402)-g, adbSNP:386518185
complement(403)-t, cdbSNP:139843362
complement(408)-t, cdbSNP:148588074
complement(417)-t, gdbSNP:141525769
complement(418)-t, cdbSNP:201772036
complement(421)-t, cdbSNP:372265184
complement(466)-g, adbSNP:200498551
complement(487)-g, adbSNP:200789364
complement(510)-t, gdbSNP:144640380
complement(572)-dbSNP:
complement(572)-g, adbSNP:375479974
complement(574)-c, adbSNP:78226748
complement(621)-g, adbSNP:267598837
complement(642)-g, cdbSNP:192715508
complement(649)-t, cdbSNP:144433180
complement(717)-t, cdbSNP:138009692
complement(780)-g, adbSNP:140343610
complement(802)-t, adbSNP:146219183
complement(804)-g, adbSNP:200794209
complement(852)-g, adbSNP:368729538
complement(896)-t, cdbSNP:147880290
complement(920)-g, cdbSNP:367691903
complement(958)-t, cdbSNP:188964071
complement(998)-t, gdbSNP:10176689
complement(1234)-, gdbSNP:370995883
1313+g, tdbSNP:15610
complement(1357..1361)-, aattgdbSNP:144284916
complement(1376)-g, cdbSNP:142194680
1402+c, gdbSNP:1071676
Gene SymbolIL1B
Gene SynonymIL-1; IL1-BETA; IL1F2
Chromosome2
Locus Map2q14
Title Cholesterol crystals induce complement-dependent inflammasome activation and cytokine release .
Author Samstad EO, Niyonzima N, Nymo S, Aune MH, Ryan L, Bakke SS, Lappegard KT, Brekke OL, Lambris JD, Damas JK, Latz E, Mollnes TE and Espevik T.
Journal J. Immunol. 192 (6), 2837-2845 (2014)
Title Association of interleukin-1beta -511 C/T polymorphism with tobacco-associated cancer in northeast India: a study on oral and gastric cancer .
Author Lakhanpal M, Yadav DS, Devi TR, Singh LC, Singh KJ, Latha SP, Chauhan PS, Verma Y, Zomavia E, Sharma J, Chandra Kataki A, Saxena
Journal Cancer Genet 207 (1-2), 1-11 (2014)
Title Do IL-1B and IL-1RN modulate chronic low back pain in patients with post-traumatic stress disorder? .
Author Loncar Z, Curic G, Mestrovic AH, Mickovic V and Bilic M.
Journal Coll Antropol 37 (4), 1237-1244 (2013)
Title Polymorphisms of the IL12B, IL1B, and TNFA genes and susceptibility to asthma .
Author Padron-Morales,J., Sanz,C., Davila,I., Munoz-Bellido,F., Lorente,F. and Isidoro-Garcia,M.
Journal J Investig Allergol Clin Immunol 23 (7), 487-494 (2013)
Title Association study between IL-1beta-511 C/T polymorphism and obsessive-compulsive disorder (OCD) in Chinese Han population .
Author Bo Y, Liu S, Yin Y, Wang Z, Cui J, Zong J, Zhang X and Li X.
Journal Int J Psychiatry Med 46 (2), 145-152 (2013)
Title The role of arginine residues in interleukin 1 receptor binding .
Author Nanduri VB, Hulmes JD, Pan YC, Kilian PL and Stern AS.
Journal Biochim. Biophys. Acta 1118 (1), 25-35 (1991)
Title Analysis of mutations in the putative nuclear localization sequence of interleukin-1 beta .
Author Grenfell S, Smithers N, Witham S, Shaw A, Graber P and Solari R.
Journal Biochem. J. 280 (PT 1), 111-116 (1991)
Title IL-1-converting enzyme requires aspartic acid residues for processing of the IL-1 beta precursor at two distinct sites and does not cleave 31-kDa IL-1 alpha .
Author Howard AD, Kostura MJ, Thornberry N, Ding GJ, Limjuco G, Weidner J, Salley JP, Hogquist KA, Chaplin DD and Mumford RA.
Journal J. Immunol. 147 (9), 2964-2969 (1991)
Title Rapid and specific conversion of precursor interleukin 1 beta (IL-1 beta) to an active IL-1 species by human mast cell chymase .
Author Mizutani H, Schechter N, Lazarus G, Black RA and Kupper TS.
Journal J. Exp. Med. 174 (4), 821-825 (1991)
Title [Elimination of introns from the interleukin 1 beta genome by DNA amplification and expression of interleukin 1 beta in Escherichia coli] .
Author Chistiakov,D.A., Arsenian,S.G., Braga,E.A., Lapidus,A.D., Kozlov,Iu.I., Mashko,S.V., Nosikov,V.V., Sverdlov,E.D. and Debabov,V.G.
Journal Mol. Biol. (Mosk.) 25 (5), 1273-1284 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.