• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 1, beta (IL1B), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000576 Homo sapiens interleukin 1, beta (IL1B), mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_000576.2, 27894305
Length 1498 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 1, beta (IL1B), mRNA.
Product interleukin-1 beta proprotein
Comment

Summary: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2008].

RefSeq NP_000567.1
CDS 88..897
Misc Feature(1)88..363
Misc Feature(2)88..363
Misc Feature(3)166..168
Misc Feature(4)166..168
Misc Feature(5)433..435
Misc Feature(6)433..435
Misc Feature(7)445..447
Misc Feature(8)454..882
Misc Feature(9)order(460..462,466..468,868..870)
Misc Feature(10)order(475..480,508..510,514..516,523..525,529..531,
Misc Feature(11)508..510
Exon (1)1..72
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Exon (2)73..134
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Exon (3)135..186
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Exon (4)187..388
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Exon (5)389..553
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Exon (6)554..684
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Exon (7)685..1498
Gene:IL1B
Gene Synonym:IL-1; IL1-BETA; IL1F2
Translation MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTKGGQDITDFTMQFVSS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(20)-dbSNP:
complement(20)-c, adbSNP:1133555
complement(26)-t, adbSNP:115403599
complement(40)-t, gdbSNP:1799916
complement(49)-t, cdbSNP:1133558
complement(135)-dbSNP:
complement(135)-g, adbSNP:137872663
complement(179)-t, adbSNP:200223008
complement(225)-dbSNP:
complement(225)-g, adbSNP:140794289
complement(226)-t, cdbSNP:140821206
complement(228)-t, gdbSNP:143589371
complement(247)-t, cdbSNP:147657695
complement(258)-t, cdbSNP:16062
complement(275)-t, cdbSNP:200278471
complement(321)-t, cdbSNP:62157449
complement(362)-g, adbSNP:200401035
complement(402)-dbSNP:
complement(402)-t, cdbSNP:1143634
complement(403)-t, cdbSNP:139843362
complement(408)-t, cdbSNP:148588074
complement(417)-t, gdbSNP:141525769
complement(418)-t, cdbSNP:201772036
complement(466)-g, adbSNP:200498551
complement(487)-g, adbSNP:200789364
complement(510)-t, gdbSNP:144640380
complement(574)-dbSNP:
complement(574)-c, adbSNP:78226748
complement(642)-g, cdbSNP:192715508
complement(649)-t, cdbSNP:144433180
complement(717)-t, cdbSNP:138009692
complement(780)-g, adbSNP:140343610
complement(802)-t, adbSNP:146219183
complement(804)-g, adbSNP:200794209
complement(896)-t, cdbSNP:147880290
complement(958)-t, cdbSNP:188964071
complement(998)-t, gdbSNP:10176689
complement(1313)-t, gdbSNP:15610
complement(1357..1361)-, aattgdbSNP:144284916
complement(1360)-, attgadbSNP:71747676
complement(1376)-g, cdbSNP:142194680
complement(1402)-g, cdbSNP:1071676
complement(1415)-, atdbSNP:71830692
Gene SymbolIL1B
Gene SynonymIL-1; IL1-BETA; IL1F2
Chromosome2
Locus Map2q14
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000576 Homo sapiens interleukin 1, beta (IL1B), mRNA. In-stock $348.00 $299.00 10
Title Tumor necrosis factor alpha- and interleukin-1beta-dependent induction of CCL3 expression by nucleus pulposus cells promotes macrophage migration through CCR1 .
Author Wang,J., Tian,Y., Phillips,K.L., Chiverton,N., Haddock,G., Bunning,R.A., Cross,A.K., Shapiro,I.M., Le Maitre,C.L. and Risbud,M.V.
Journal Arthritis Rheum. 65 (3), 832-842 (2013)
Title Self double-stranded (ds)DNA induces IL-1beta production from human monocytes by activating NLRP3 inflammasome in the presence of anti-dsDNA antibodies .
Author Shin,M.S., Kang,Y., Lee,N., Wahl,E.R., Kim,S.H., Kang,K.S., Lazova,R. and Kang,I.
Journal J. Immunol. 190 (4), 1407-1415 (2013)
Title Analysis of human bronchial epithelial cell proinflammatory response to Burkholderia cenocepacia infection: inability to secrete il-1beta .
Author Gillette,D.D., Shah,P.A., Cremer,T., Gavrilin,M.A., Besecker,B.Y., Sarkar,A., Knoell,D.L., Cormet-Boyaka,E., Wewers,M.D., Butchar,J.P. and Tridandapani,S.
Journal J. Biol. Chem. 288 (6), 3691-3695 (2013)
Title Evaluation of interleukin 1beta in febrile convulsion .
Author Behmanesh,F., Ashrafzadeh,F., Varasteh,A., Shakeri,A. and Shahsavand,S.
Journal Iran J Allergy Asthma Immunol 11 (4), 336-339 (2012)
Title Prevalence of IL-1beta +3954 and IL-1alpha-889 polymorphisms in the Lebanese population and its association with the severity of adult chronic periodontitis .
Author Tawil,G., Akl,F.A., Dagher,M.F., Karam,W., Abdallah Hajj Hussein,I., Leone,A. and Jurjus,A.R.
Journal J. Biol. Regul. Homeost. Agents 26 (4), 597-606 (2012)
Title The role of arginine residues in interleukin 1 receptor binding .
Author Nanduri,V.B., Hulmes,J.D., Pan,Y.C., Kilian,P.L. and Stern,A.S.
Journal Biochim. Biophys. Acta 1118 (1), 25-35 (1991)
Title Analysis of mutations in the putative nuclear localization sequence of interleukin-1 beta .
Author Grenfell,S., Smithers,N., Witham,S., Shaw,A., Graber,P. and Solari,R.
Journal Biochem. J. 280 (PT 1), 111-116 (1991)
Title IL-1-converting enzyme requires aspartic acid residues for processing of the IL-1 beta precursor at two distinct sites and does not cleave 31-kDa IL-1 alpha .
Author Howard,A.D., Kostura,M.J., Thornberry,N., Ding,G.J., Limjuco,G., Weidner,J., Salley,J.P., Hogquist,K.A., Chaplin,D.D., Mumford,R.A. et al.
Journal J. Immunol. 147 (9), 2964-2969 (1991)
Title Rapid and specific conversion of precursor interleukin 1 beta (IL-1 beta) to an active IL-1 species by human mast cell chymase .
Author Mizutani,H., Schechter,N., Lazarus,G., Black,R.A. and Kupper,T.S.
Journal J. Exp. Med. 174 (4), 821-825 (1991)
Title [Elimination of introns from the interleukin 1 beta genome by DNA amplification and expression of interleukin 1 beta in Escherichia coli] .
Author Chistiakov,D.A., Arsenian,S.G., Braga,E.A., Lapidus,A.D., Kozlov,Iu.I., Mashko,S.V., Nosikov,V.V., Sverdlov,E.D. and Debabov,V.G.
Journal Mol. Biol. (Mosk.) 25 (5), 1273-1284 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.