• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-C motif) receptor 5 (gene/pseudogene) (CCR5), transcript variant A, mRNA.


RefSeq Accession Definition Services Price Order
NM_000579 Homo sapiens chemokine (C-C motif) receptor 5 (gene/pseudogene) (CCR5), transcript variant A, mRNA. ORF Sequence $307.11
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000579.3, 154091329
Length 3686 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) receptor 5 (gene/pseudogene) (CCR5), transcript variant A, mRNA.
Product C-C chemokine receptor type 5
Comment

Summary: This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (A) represents the longer transcript. Both variants encode the same protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by published experimental evidence.

RefSeq NP_000570.1
CDS 358..1416
Misc Feature(1)277..279
Misc Feature(2)364..366
Misc Feature(3)364..366
Misc Feature(4)364..366
Misc Feature(5)373..375
Misc Feature(6)385..387
Misc Feature(7)385..387
Misc Feature(8)394..1338
Misc Feature(9)397..399
Misc Feature(10)397..399
Misc Feature(11)400..402
Misc Feature(12)448..531
Misc Feature(13)562..624
Misc Feature(14)664..729
Misc Feature(15)781..855
Misc Feature(16)952..1011
Misc Feature(17)1063..1137
Misc Feature(18)1189..1260
Misc Feature(19)1318..1320
Misc Feature(20)1324..1326
Misc Feature(21)1327..1329
Misc Feature(22)1363..1365
Misc Feature(23)1363..1365
Misc Feature(24)1366..1368
Misc Feature(25)1366..1368
Misc Feature(26)1381..1383
Misc Feature(27)1381..1383
Misc Feature(28)1402..1404
Misc Feature(29)1402..1404
Exon (1)1..57
Gene:CCR5
Gene Synonym:CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5; CKR5; CMKBR5; IDDM22
Exon (2)58..346
Gene:CCR5
Gene Synonym:CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5; CKR5; CMKBR5; IDDM22
Exon (3)347..3661
Gene:CCR5
Gene Synonym:CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5; CKR5; CMKBR5; IDDM22
Translation MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
29+dbSNP:
29+a, gdbSNP:2856758
43+c, tdbSNP:2856759
111+dbSNP:
111+a, gdbSNP:147420214
115+c, tdbSNP:201495177
116+a, gdbSNP:200068037
126+c, tdbSNP:1799988
129+c, tdbSNP:41469351
140+c, tdbSNP:3087249
149+c, tdbSNP:2856760
175+a, gdbSNP:1800023
183+c, tdbSNP:200298802
195+a, cdbSNP:201042276
204+c, tdbSNP:111233598
211+c, gdbSNP:202208604
213+c, gdbSNP:41355345
235+a, cdbSNP:3087250
348+dbSNP:
348+c, gdbSNP:184985767
400+c, tdbSNP:200209014
409+a, gdbSNP:142904831
415+a, tdbSNP:145061115
434+a, gdbSNP:189601230
442+g, tdbSNP:1800939
449+a, gdbSNP:56340326
462+a, gdbSNP:113471490
493+a, gdbSNP:41425744
521+a, tdbSNP:1799863
522+g, tdbSNP:148106779
537+g, tdbSNP:1800940
544+a, tdbSNP:142829420
557+c, tdbSNP:199722561
559+c, tdbSNP:138220300
573+a, gdbSNP:143880323
575+c, tdbSNP:56198941
582+c, tdbSNP:1800941
640+a, gdbSNP:149975182
660+a, tdbSNP:1800560
666+c, gdbSNP:56068070
673+a, gdbSNP:183662584
676+c, tdbSNP:138174483
695+c, tdbSNP:200815713
717+c, tdbSNP:200108729
719+g, tdbSNP:150497029
729+c, tdbSNP:138380934
730+a, gdbSNP:146209111
739+c, tdbSNP:201179081
748+g, tdbSNP:34418657
834+a, gdbSNP:55639502
849+a, cdbSNP:1800942
889+c, tdbSNP:199824195
911..942+, gtcagtatcaattctggaagaatttccagacadbSNP:333
911+g, tdbSNP:112590754
912+g, tdbSNP:111718604
913+a, cdbSNP:113869679
925+c, tdbSNP:201797884
932+a, tdbSNP:199827265
936+c, gdbSNP:56345960
939+a, cdbSNP:62625034
974+c, tdbSNP:113552054
975+a, gdbSNP:139737901
1016+c, tdbSNP:151126808
1023+g, tdbSNP:201290940
1024+c, tdbSNP:200419576
1025+a, gdbSNP:1800452
1030+c, tdbSNP:146972949
1062+g, tdbSNP:147615392
1076+c, tdbSNP:199780106
1079+c, tdbSNP:201301850
1094+c, tdbSNP:143181119
1098+c, tdbSNP:141139165
1127+a, tdbSNP:142469507
1163+g, tdbSNP:184279915
1181+g, tdbSNP:112762802
1199+c, tdbSNP:139358456
1217+g, tdbSNP:55956105
1219+a, gdbSNP:150592242
1224+c, gdbSNP:149622978
1228+c, tdbSNP:200740810
1258+a, gdbSNP:55916127
1259+g, tdbSNP:1800943
1309+a, gdbSNP:188772198
1345..1346+, cdbSNP:34962689
1347+a, gdbSNP:35853487
1348+c, gdbSNP:199846907
1350+c, tdbSNP:201780857
1353+c, tdbSNP:148802293
1357+a, c, tdbSNP:147879075
1361+c, tdbSNP:1800944
1373+a, tdbSNP:1800945
1395+a, gdbSNP:2157060
1419+c, tdbSNP:191297617
1528+c, gdbSNP:146080174
1610+a, gdbSNP:112622745
1653+a, gdbSNP:183840358
1706+c, gdbSNP:41414147
1779+c, tdbSNP:143589063
2036+a, tdbSNP:145725153
2109+a, gdbSNP:41495153
2115+a, gdbSNP:142957506
2133+a, gdbSNP:151122728
2180+c, tdbSNP:17765882
2200+a, gdbSNP:41418945
2203+a, gdbSNP:41466044
2225+a, gdbSNP:190456231
2360+a, gdbSNP:41345848
2362+a, gdbSNP:141257116
2386+c, tdbSNP:200501663
2402+a, tdbSNP:201290180
2406+a, gdbSNP:199648605
2434+g, tdbSNP:1800874
2444+a, cdbSNP:200364389
2460+c, gdbSNP:201423367
2472+c, tdbSNP:186889269
2507+c, gdbSNP:146926765
2562+g, tdbSNP:137866928
2582+c, tdbSNP:41535253
2650+a, gdbSNP:41526948
2662+c, tdbSNP:77024144
2814+c, tdbSNP:201417500
2815+a, cdbSNP:3188094
2819+a, gdbSNP:190094030
2843+c, tdbSNP:181602248
2847+c, gdbSNP:185327310
2929+g, tdbSNP:1048115
3022+g, tdbSNP:141737357
3033+a, cdbSNP:41442546
3130+a, gdbSNP:190136403
3188+c, tdbSNP:182052831
3195+c, gdbSNP:41512547
3276+a, cdbSNP:746492
3278+c, tdbSNP:200688955
3290+g, tdbSNP:186138215
3304+a, tdbSNP:192256035
3446+a, gdbSNP:184040468
3489+g, tdbSNP:188577829
Gene SymbolCCR5
Gene SynonymCC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5; CKR5; CMKBR5; IDDM22
Chromosome3
Locus Map3p21.31
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000579 Homo sapiens chemokine (C-C motif) receptor 5 (gene/pseudogene) (CCR5), transcript variant A, mRNA. Full Length $1290.10
ORF Sequence $307.11
NM_001100168 Homo sapiens chemokine (C-C motif) receptor 5 (gene/pseudogene) (CCR5), transcript variant B, mRNA. Full Length $1207.85
ORF Sequence $307.11
Title CCR5 is a receptor for Staphylococcus aureus leukotoxin ED .
Author Alonzo,F. III, Kozhaya,L., Rawlings,S.A., Reyes-Robles,T., DuMont,A.L., Myszka,D.G., Landau,N.R., Unutmaz,D. and Torres,V.J.
Journal Nature 493 (7430), 51-55 (2013)
Title Macropinocytosis-like HIV-1 internalization in macrophages is CCR5 dependent and leads to efficient but delayed degradation in endosomal compartments .
Author Gobeil,L.A., Lodge,R. and Tremblay,M.J.
Journal J. Virol. 87 (2), 735-745 (2013)
Title Macrophage-tropic HIV-1 variants from brain demonstrate alterations in the way gp120 engages both CD4 and CCR5 .
Author Salimi,H., Roche,M., Webb,N., Gray,L.R., Chikere,K., Sterjovski,J., Ellett,A., Wesselingh,S.L., Ramsland,P.A., Lee,B., Churchill,M.J. and Gorry,P.R.
Journal J. Leukoc. Biol. 93 (1), 113-126 (2013)
Title Tumor-infiltrating monocytic myeloid-derived suppressor cells mediate CCR5-dependent recruitment of regulatory T cells favoring tumor growth .
Author Schlecker,E., Stojanovic,A., Eisen,C., Quack,C., Falk,C.S., Umansky,V. and Cerwenka,A.
Journal J. Immunol. 189 (12), 5602-5611 (2012)
Title [CCR5, CCR2, apoe, p53, ITGB3 and HFE gene polymorphism in Western Siberia long-livers] .
Author Ivanoshchuk,D.E., Mikhailova,S.V., Kulikov,I.V., Maksimov,V.N., Voevoda,M.I. and Romashchenko,A.G.
Journal Adv Gerontol 25 (3), 394-397 (2012)
Title Retropseudogenes constitute the major part of the human elongation factor 1 alpha gene family .
Author Madsen,H.O., Poulsen,K., Dahl,O., Clark,B.F. and Hjorth,J.P.
Journal Nucleic Acids Res. 18 (6), 1513-1516 (1990)
Title Murine elongation factor 1 alpha (EF-1 alpha) is posttranslationally modified by novel amide-linked ethanolamine-phosphoglycerol moieties. Addition of ethanolamine-phosphoglycerol to specific glutamic acid residues on EF-1 alpha .
Author Whiteheart,S.W., Shenbagamurthi,P., Chen,L., Cotter,R.J. and Hart,G.W.
Journal J. Biol. Chem. 264 (24), 14334-14341 (1989)
Title Isolation and characterization of the human chromosomal gene for polypeptide chain elongation factor-1 alpha .
Author Uetsuki,T., Naito,A., Nagata,S. and Kaziro,Y.
Journal J. Biol. Chem. 264 (10), 5791-5798 (1989)
Title Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs .
Author Itoh,H., Toyama,R., Kozasa,T., Tsukamoto,T., Matsuoka,M. and Kaziro,Y.
Journal J. Biol. Chem. 263 (14), 6656-6664 (1988)
Title Retinol-regulated gene expression in human tracheobronchial epithelial cells. Enhanced expression of elongation factor EF-1 alpha .
Author Ann,D.K., Wu,M.M., Huang,T., Carlson,D.M. and Wu,R.
Journal J. Biol. Chem. 263 (8), 3546-3549 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878