• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-C motif) receptor 5 (gene/pseudogene) (CCR5), transcript variant A, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu20119 Homo sapiens chemokine (C-C motif) receptor 5 (gene/pseudogene) (CCR5), transcript variant A, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu20119C Homo sapiens chemokine (C-C motif) receptor 5 (gene/pseudogene) (CCR5), transcript variant A, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000579.3, 154091329
Length 1059 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) receptor 5 (gene/pseudogene) (CCR5), transcript variant A, mRNA.
Product C-C chemokine receptor type 5
Comment

Summary: This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (A) represents the longer transcript. Both variants encode the same protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by published experimental evidence.

RefSeq NP_000570.1
CDS 358..1416
Misc Feature(1)277..279
Misc Feature(2)364..366
Misc Feature(3)364..366
Misc Feature(4)364..366
Misc Feature(5)373..375
Misc Feature(6)385..387
Misc Feature(7)385..387
Misc Feature(8)397..399
Misc Feature(9)397..399
Misc Feature(10)400..402
Misc Feature(11)448..531
Misc Feature(12)532..1248
Misc Feature(13)562..624
Misc Feature(14)664..729
Misc Feature(15)781..855
Misc Feature(16)952..1011
Misc Feature(17)1063..1137
Misc Feature(18)1189..1260
Misc Feature(19)1318..1320
Misc Feature(20)1324..1326
Misc Feature(21)1327..1329
Misc Feature(22)1363..1365
Misc Feature(23)1363..1365
Misc Feature(24)1366..1368
Misc Feature(25)1366..1368
Misc Feature(26)1381..1383
Misc Feature(27)1381..1383
Misc Feature(28)1402..1404
Misc Feature(29)1402..1404
Exon (1)1..57
Gene:CCR5
Gene Synonym:CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5; CKR5; CMKBR5; IDDM22
Exon (2)58..346
Gene:CCR5
Gene Synonym:CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5; CKR5; CMKBR5; IDDM22
Exon (3)347..3661
Gene:CCR5
Gene Synonym:CC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5; CKR5; CMKBR5; IDDM22
Translation MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
29+dbSNP:
29+a, gdbSNP:2856758
43+c, tdbSNP:2856759
111+dbSNP:
111+a, gdbSNP:147420214
115+c, tdbSNP:201495177
116+a, gdbSNP:200068037
126+c, tdbSNP:1799988
129+c, tdbSNP:41469351
140+c, tdbSNP:3087249
149+c, tdbSNP:2856760
175+a, gdbSNP:1800023
183+c, tdbSNP:200298802
195+a, cdbSNP:201042276
204+c, tdbSNP:111233598
211+c, gdbSNP:202208604
213+c, gdbSNP:41355345
235+a, cdbSNP:3087250
348+dbSNP:
348+c, gdbSNP:184985767
400+c, tdbSNP:200209014
407+a, cdbSNP:369206494
409+a, gdbSNP:142904831
415+a, tdbSNP:145061115
434+a, gdbSNP:189601230
442+g, tdbSNP:1800939
449+a, gdbSNP:56340326
451+c, tdbSNP:374426321
462+a, gdbSNP:113471490
493+a, gdbSNP:41425744
521+a, tdbSNP:1799863
522+g, tdbSNP:148106779
537+g, tdbSNP:1800940
544+a, tdbSNP:142829420
557+c, tdbSNP:199722561
573+a, gdbSNP:143880323
575+c, tdbSNP:56198941
582+c, tdbSNP:1800941
634+c, gdbSNP:376364792
640+a, gdbSNP:149975182
660+a, tdbSNP:1800560
666+c, gdbSNP:56068070
673+a, gdbSNP:183662584
676+c, tdbSNP:138174483
695+c, tdbSNP:200815713
715+a, gdbSNP:370409212
717+c, tdbSNP:200108729
719+g, tdbSNP:150497029
729+c, tdbSNP:138380934
730+a, gdbSNP:146209111
739+a, c, tdbSNP:201179081
748+g, tdbSNP:34418657
779+c, tdbSNP:371901382
834+a, gdbSNP:55639502
849+a, c, gdbSNP:1800942
851+c, tdbSNP:372054532
863+a, cdbSNP:376687230
872+a, cdbSNP:377330713
888+c, tdbSNP:369351284
889+c, tdbSNP:199824195
911..942+, gtcagtatcaattctggaagaatttccagacadbSNP:333
911+g, tdbSNP:112590754
912+g, tdbSNP:111718604
913+a, cdbSNP:113869679
917+a, gdbSNP:372782701
925+c, tdbSNP:201797884
932+a, tdbSNP:199827265
936+c, gdbSNP:56345960
939+a, cdbSNP:62625034
974+c, tdbSNP:113552054
975+a, gdbSNP:139737901
1002+a, gdbSNP:376137306
1004+g, tdbSNP:371598347
1016+c, tdbSNP:151126808
1023+g, tdbSNP:201290940
1024+c, tdbSNP:200419576
1025+a, gdbSNP:1800452
1030+c, tdbSNP:146972949
1035+c, tdbSNP:373358134
1057+c, gdbSNP:371621013
1062+g, tdbSNP:147615392
1076+a, c, tdbSNP:199780106
1079+c, tdbSNP:201301850
1094+c, tdbSNP:143181119
1098+c, tdbSNP:141139165
1116+c, tdbSNP:367851873
1127+a, tdbSNP:142469507
1163+a, g, tdbSNP:184279915
1181+g, tdbSNP:112762802
1196+a, cdbSNP:374495269
1217+g, tdbSNP:55956105
1219+a, gdbSNP:150592242
1221+a, gdbSNP:372879037
1224+c, gdbSNP:149622978
1228+c, tdbSNP:200740810
1231+a, gdbSNP:375777270
1239+c, tdbSNP:368391698
1258+a, gdbSNP:55916127
1259+g, tdbSNP:1800943
1302+c, tdbSNP:371813238
1309+a, gdbSNP:188772198
1312+c, tdbSNP:374959868
1313+a, gdbSNP:369373756
1341+c, gdbSNP:372786661
1345..1346+, cdbSNP:34962689
1347+a, gdbSNP:35853487
1348+c, gdbSNP:199846907
1350+c, tdbSNP:201780857
1353+c, tdbSNP:148802293
1357+a, c, tdbSNP:147879075
1361+c, tdbSNP:1800944
1373+a, tdbSNP:1800945
1388+g, tdbSNP:375916464
1395+a, gdbSNP:2157060
1419+c, tdbSNP:191297617
1528+c, gdbSNP:146080174
1610+a, gdbSNP:112622745
1653+a, gdbSNP:183840358
1706+c, gdbSNP:41414147
1779+c, tdbSNP:143589063
1915+c, tdbSNP:369515918
2036+a, tdbSNP:145725153
2068+c, tdbSNP:373926603
2109+a, gdbSNP:41495153
2109+c, tdbSNP:386445548
2115+a, gdbSNP:142957506
complement(2133)-g, adbSNP:151122728
2153+c, tdbSNP:375306827
2180+c, tdbSNP:17765882
2180+c, tdbSNP:386428449
2200+a, gdbSNP:41418945
2203+a, gdbSNP:41466044
2225+a, gdbSNP:190456231
2360+a, gdbSNP:41345848
2362+a, gdbSNP:141257116
2386+c, tdbSNP:200501663
2402+a, tdbSNP:201290180
2406+a, gdbSNP:199648605
2434+g, tdbSNP:1800874
2444+a, cdbSNP:200364389
2460+c, gdbSNP:201423367
2472+c, tdbSNP:186889269
2507+c, gdbSNP:146926765
2562+g, tdbSNP:137866928
2582+c, tdbSNP:41535253
2650+a, gdbSNP:41526948
2662+c, tdbSNP:77024144
2814+c, tdbSNP:201417500
complement(2815)-c, adbSNP:3188094
2819+a, gdbSNP:190094030
2843+c, tdbSNP:181602248
2847+c, gdbSNP:185327310
2929+g, tdbSNP:1048115
3022+g, tdbSNP:141737357
3033+a, cdbSNP:41442546
3130+a, gdbSNP:190136403
3136+a, gdbSNP:376306118
3188+c, tdbSNP:182052831
3195+c, gdbSNP:41512547
complement(3276)-c, adbSNP:746492
3278+c, tdbSNP:200688955
3290+g, tdbSNP:186138215
3304+a, tdbSNP:192256035
3446+a, gdbSNP:184040468
3462+a, gdbSNP:370386700
3489+g, tdbSNP:188577829
3534+a, gdbSNP:374785441
Gene SymbolCCR5
Gene SynonymCC-CKR-5; CCCKR5; CCR-5; CD195; CKR-5; CKR5; CMKBR5; IDDM22
Chromosome3
Locus Map3p21.31
Title Inhibition of R5-tropic HIV type-1 replication in CD4(+) natural killer T cells by gammadelta T lymphocytes .
Author Omi K, Shimizu M, Watanabe E, Matsumura J, Takaku C, Shinya E and Takahashi H.
Journal Immunology 141 (4), 596-608 (2014)
Title Identification of a binding element for the cytoplasmic regulator .
Author Toda E, Terashima Y, Esaki K, Yoshinaga S, Sugihara M, Kofuku Y, Shimada I, Suwa M, Kanegasaki S, Terasawa H and Matsushima K.
Journal Biochem. J. 457 (2), 313-322 (2014)
Title CCL3L1 copy number, CCR5 genotype and susceptibility to tuberculosis .
Author Carpenter D, Taype C, Goulding J, Levin M, Eley B, Anderson S, Shaw
Journal BMC Med. Genet. 15, 5 (2014)
Title CXCR3/CCR5 pathways in metastatic melanoma patients treated with adoptive therapy and interleukin-2 .
Author Bedognetti D, Spivey TL, Zhao Y, Uccellini L, Tomei S, Dudley ME, Ascierto ML, De Giorgi V, Liu Q, Delogu LG, Sommariva M, Sertoli MR, Simon R, Wang E, Rosenberg SA and Marincola FM.
Journal Br. J. Cancer 109 (9), 2412-2423 (2013)
Title Design of substituted imidazolidinylpiperidinylbenzoic acids as chemokine receptor 5 antagonists: potent inhibitors of R5 HIV-1 replication .
Author Skerlj R, Bridger G, Zhou Y, Bourque E, McEachern E, Metz M, Harwig C, Li TS, Yang W, Bogucki D, Zhu Y, Langille J, Veale D, Ba T, Bey M, Baird I, Kaller A, Krumpak M, Leitch D, Satori M, Vocadlo K, Guay D, Nan S, Yee H, Crawford J, Chen G, Wilson T, Carpenter B, Gauthier D, Macfarland R, Mosi R, Bodart V, Wong R, Fricker S and Schols D.
Journal J. Med. Chem. 56 (20), 8049-8065 (2013)
Title Retropseudogenes constitute the major part of the human elongation factor 1 alpha gene family .
Author Madsen HO, Poulsen K, Dahl O, Clark BF and Hjorth JP.
Journal Nucleic Acids Res. 18 (6), 1513-1516 (1990)
Title Murine elongation factor 1 alpha (EF-1 alpha) is posttranslationally modified by novel amide-linked ethanolamine-phosphoglycerol moieties. Addition of ethanolamine-phosphoglycerol to specific glutamic acid residues on EF-1 alpha .
Author Whiteheart SW, Shenbagamurthi P, Chen L, Cotter RJ and Hart GW.
Journal J. Biol. Chem. 264 (24), 14334-14341 (1989)
Title Isolation and characterization of the human chromosomal gene for polypeptide chain elongation factor-1 alpha .
Author Uetsuki T, Naito A, Nagata S and Kaziro Y.
Journal J. Biol. Chem. 264 (10), 5791-5798 (1989)
Title Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs .
Author Itoh H, Toyama R, Kozasa T, Tsukamoto T, Matsuoka M and Kaziro Y.
Journal J. Biol. Chem. 263 (14), 6656-6664 (1988)
Title Retinol-regulated gene expression in human tracheobronchial epithelial cells. Enhanced expression of elongation factor EF-1 alpha .
Author Ann DK, Wu MM, Huang T, Carlson DM and Wu R.
Journal J. Biol. Chem. 263 (8), 3546-3549 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.