• THAT   AND
  • THAT   AND


Homo sapiens interleukin 8 (IL8), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_000584 Homo sapiens interleukin 8 (IL8), mRNA. Full Lenth $498.22
ORF Sequence $159.00


RefSeq Version NM_000584.3, 324073503
Length 1718 bp
Structure linear
Update Date 01-MAY-2011
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 8 (IL8), mRNA.
Product interleukin-8 precursor
Comment

Summary: The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. [provided by RefSeq].

RefSeq NP_000575.1
CDS 154..453
Exon (1)1..217
Exon (2)1..217
Exon (3)218..353
Exon (4)354..437
Exon (5)438..1705
Translation MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolIL8
Gene SynonymCXCL8; GCP-1; GCP1; LECT; LUCT; LYNAP; MDNCF; MONAP; NAF; NAP-1; NAP1
Chromosome4
Locus Map4q13-q21
All Transcripts NM_000584
Title Autophagy is required for toll-like receptor-mediated interleukin-8 production in intestinal epithelial cells .
Author Li,Y.Y., Ishihara,S., Aziz,M.M., Oka,A., Kusunoki,R., Tada,Y., Yuki,T., Amano,Y., Ansary,M.U. and Kinoshita,Y.
Journal Int. J. Mol. Med. 27 (3), 337-344 (2011)
Title Human CD4+ FOXP3+ regulatory T cells produce CXCL8 and recruit neutrophils .
Author Himmel,M.E., Crome,S.Q., Ivison,S., Piccirillo,C., Steiner,T.S. and Levings,M.K.
Journal Eur. J. Immunol. 41 (2), 306-312 (2011)
Title Engagement of toll-like receptor 3 induces vascular endothelial growth factor and interleukin-8 in human rheumatoid synovial fibroblasts .
Author Moon,S.J., Park,M.K., Oh,H.J., Lee,S.Y., Kwok,S.K., Cho,M.L., Ju,J.H., Park,K.S., Kim,H.Y. and Park,S.H.
Journal Korean J. Intern. Med. 25 (4), 429-435 (2010)
Title Umbilical cord blood concentrations of IL-6, IL-8, and MMP-8 in pregnancy complicated by preterm premature rupture of the membranes and histological chorioamnionitis .
Author Andrys,C., Drahosova,M., Hornychova,H., Tambor,V., Musilova,I., Tosner,J., Flidrova,E. and Kacerovsky,M.
Journal Neuro Endocrinol. Lett. 31 (6), 857-863 (2010)
Title HIV-1 gp120-mediated increases in IL-8 production in astrocytes are mediated through the NF-kappaB pathway and can be silenced by gp120-specific siRNA .
Author Shah,A. and Kumar,A.
Journal J Neuroinflammation 7, 96 (2010)
Title Interleukin-8 as a macrophage-derived mediator of angiogenesis .
Author Koch,A.E., Polverini,P.J., Kunkel,S.L., Harlow,L.A., DiPietro,L.A., Elner,V.M., Elner,S.G. and Strieter,R.M.
Journal Science 258 (5089), 1798-1801 (1992)
Title Human placenta constitutively produces interleukin-8 during pregnancy and enhances its production in intrauterine infection .
Author Shimoya,K., Matsuzaki,N., Taniguchi,T., Kameda,T., Koyama,M., Neki,R., Saji,F. and Tanizawa,O.
Journal Biol. Reprod. 47 (2), 220-226 (1992)
Title Interleukin-8, a chemotactic and inflammatory cytokine .
Author Baggiolini,M. and Clark-Lewis,I.
Journal FEBS Lett. 307 (1), 97-101 (1992)
Title Structure and functional expression of a human interleukin-8 receptor .
Author Holmes,W.E., Lee,J., Kuang,W.J., Rice,G.C. and Wood,W.I.
Journal Science 253 (5025), 1278-1280 (1991)
Title Selective attraction of monocytes and T lymphocytes of the memory phenotype by cytokine RANTES .
Author Schall,T.J., Bacon,K., Toy,K.J. and Goeddel,D.V.
Journal Nature 347 (6294), 669-671 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878