• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-X-C motif) ligand 8 (CXCL8), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu20145 Homo sapiens chemokine (C-X-C motif) ligand 8 (CXCL8), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu20145C Homo sapiens chemokine (C-X-C motif) ligand 8 (CXCL8), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000584.3, 324073503
Length 300 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-X-C motif) ligand 8 (CXCL8), mRNA.
Product interleukin-8 precursor
Comment

Summary: The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. [provided by RefSeq, Jul 2008].

RefSeq NP_000575.1
CDS 154..453
Misc Feature(1)58..60
Misc Feature(2)232..237
Misc Feature(3)232..234
Misc Feature(4)232..234
Misc Feature(5)235..240
Misc Feature(6)235..237
Misc Feature(7)244..435
Misc Feature(8)order(244..252,268..270,283..300,325..333,361..366,
Misc Feature(9)244..252
Misc Feature(10)order(247..249,256..258,298..303,310..318,346..357,
Misc Feature(11)order(247..249,256..258,310..312,316..318,346..348,
Misc Feature(12)order(250..255,259..261)
Misc Feature(13)order(256..276,283..300)
Misc Feature(14)order(262..267,271..273,283..285,295..297,352..354,
Misc Feature(15)order(286..288,292..294,394..396,403..405,409..420,
Misc Feature(16)order(292..294,301..303,358..360,364..366,373..378)
Misc Feature(17)order(298..303,313..315,349..351,355..357,385..387,
Misc Feature(18)325..333
Misc Feature(19)325..333
Misc Feature(20)364..372
Exon (1)1..217
Gene:CXCL8
Gene Synonym:GCP-1; GCP1; IL8; LECT; LUCT; LYNAP; MDNCF; MONAP; NAF; NAP-1; NAP1
Exon (2)218..353
Gene:CXCL8
Gene Synonym:GCP-1; GCP1; IL8; LECT; LUCT; LYNAP; MDNCF; MONAP; NAF; NAP-1; NAP1
Exon (3)354..437
Gene:CXCL8
Gene Synonym:GCP-1; GCP1; IL8; LECT; LUCT; LYNAP; MDNCF; MONAP; NAF; NAP-1; NAP1
Exon (4)438..1705
Gene:CXCL8
Gene Synonym:GCP-1; GCP1; IL8; LECT; LUCT; LYNAP; MDNCF; MONAP; NAF; NAP-1; NAP1
Translation MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
5+dbSNP:
5+a, gdbSNP:201529644
9+a, cdbSNP:200170390
26+c, gdbSNP:200985494
46+c, tdbSNP:201952119
47+a, gdbSNP:200094083
125+c, tdbSNP:201217708
126+a, gdbSNP:2227537
133+a, gdbSNP:56002960
152+a, cdbSNP:200141723
153+c, tdbSNP:2227538
164+a, cdbSNP:202071309
169+g, tdbSNP:200602609
171+c, tdbSNP:1803205
176+a, cdbSNP:202202182
194+a, tdbSNP:200254616
226+c, tdbSNP:150567416
228+a, gdbSNP:201644683
235+a, cdbSNP:199855020
244+g, tdbSNP:188378669
245+a, cdbSNP:138567132
256+a, cdbSNP:149273289
270+a, gdbSNP:372900552
274+a, tdbSNP:144469788
281+a, cdbSNP:200107073
287+a, gdbSNP:139503118
288+c, tdbSNP:202194050
303+a, gdbSNP:200090643
312+a, gdbSNP:145018121
315+a, gdbSNP:369065964
317+a, tdbSNP:202114642
328+c, tdbSNP:373821605
336+c, tdbSNP:147544998
337+a, gdbSNP:140214046
344+c, gdbSNP:142957504
369+dbSNP:
369+c, tdbSNP:371104442
375+a, gdbSNP:199638674
402+a, cdbSNP:373408845
420+a, gdbSNP:370518457
431+a, tdbSNP:200662278
434+a, gdbSNP:185040023
440+dbSNP:
440+c, tdbSNP:200005090
447+c, tdbSNP:200831742
451..452+, adbSNP:201169323
452+a, tdbSNP:201643630
468+c, tdbSNP:111499831
495+c, gdbSNP:202131481
515+c, tdbSNP:201064770
528+c, tdbSNP:181891593
533+a, gdbSNP:202212802
541+a, tdbSNP:200157654
591+a, tdbSNP:200772595
602+a, gdbSNP:186487125
624+c, gdbSNP:201795267
663+g, tdbSNP:200332241
683+a, gdbSNP:191013479
684+a, gdbSNP:111708033
685+a, tdbSNP:12420
688+a, tdbSNP:201232993
696+a, gdbSNP:16849942
702+a, gdbSNP:3181685
708+a, gdbSNP:202111883
711+g, tdbSNP:200298685
717+c, tdbSNP:201402794
730+c, tdbSNP:199733277
731+g, tdbSNP:115993429
752+a, cdbSNP:201293456
757+a, cdbSNP:199653977
766+a, gdbSNP:200660960
768+c, tdbSNP:202005234
771+c, gdbSNP:11733933
780+c, tdbSNP:181377418
784+c, gdbSNP:201465564
798+a, gdbSNP:200087373
870+a, gdbSNP:201019582
884+g, tdbSNP:201581203
895+a, gdbSNP:2227544
937+g, tdbSNP:201056346
967+g, tdbSNP:202210907
969+a, gdbSNP:200553398
988+a, gdbSNP:201094311
992+, adbSNP:35607711
999+a, cdbSNP:2227545
1003+a, gdbSNP:71532822
1026+c, tdbSNP:200386331
1047+c, tdbSNP:201400317
1062+a, cdbSNP:199798685
1105..1107+, ttadbSNP:373408246
1105+c, tdbSNP:200292642
1114+a, gdbSNP:201432677
1134+a, cdbSNP:199716768
1195+c, tdbSNP:2227550
1218+g, tdbSNP:201379863
1241+c, tdbSNP:34915905
1259+a, gdbSNP:2227546
1265+c, tdbSNP:201526399
1274+a, c, gdbSNP:71534297
1281+a, tdbSNP:200726942
1290+a, tdbSNP:201695611
1294+c, tdbSNP:200116851
1317+a, tdbSNP:1126647
1336+c, gdbSNP:202137237
1353+a, tdbSNP:199842999
1371+c, tdbSNP:200968841
1376+c, tdbSNP:202126985
1379+c, tdbSNP:200549660
1395+c, tdbSNP:201486099
1407+a, tdbSNP:202034714
1419+a, gdbSNP:200380296
1423+g, tdbSNP:201155499
1424+a, gdbSNP:199840031
complement(1428)-c, adbSNP:11545234
1485+c, tdbSNP:200462525
1495+a, tdbSNP:201137776
1530+a, gdbSNP:199713665
1555+c, tdbSNP:200908958
1564+a, cdbSNP:183164466
1583+a, gdbSNP:187944565
1619+c, tdbSNP:201880994
1626+a, tdbSNP:199812157
1671+c, tdbSNP:2227548
Gene SymbolCXCL8
Gene SynonymGCP-1; GCP1; IL8; LECT; LUCT; LYNAP; MDNCF; MONAP; NAF; NAP-1; NAP1
Chromosome4
Locus Map4q13-q21
Title TSG-6 inhibits neutrophil migration via direct interaction with the chemokine CXCL8 .
Author Dyer DP, Thomson JM, Hermant A, Jowitt TA, Handel TM, Proudfoot AE, Day AJ and Milner CM.
Journal J. Immunol. 192 (5), 2177-2185 (2014)
Title Dynamics of chemokine, cytokine, and growth factor serum levels in BRAF-mutant melanoma patients during BRAF inhibitor treatment .
Author Wilmott JS, Haydu LE, Menzies AM, Lum T, Hyman J, Thompson JF, Hersey P, Kefford RF, Scolyer RA and Long GV.
Journal J. Immunol. 192 (5), 2505-2513 (2014)
Title Proteasome inhibition increases recruitment of IkappaB kinase beta (IKKbeta), S536P-p65, and transcription factor EGR1 to interleukin-8 (IL-8) promoter, resulting in increased IL-8 production in ovarian cancer cells .
Author Singha B, Gatla HR, Manna S, Chang TP, Sanacora S, Poltoratsky V, Vancura A and Vancurova I.
Journal J. Biol. Chem. 289 (5), 2687-2700 (2014)
Title Blood eosinophil and platelet levels, proteomics patterns of trail and CXCL8 correlated with survival in bevacizumab treated metastatic colon cancers .
Author Yalcin,A.D., Kargi,A., Gumuslu,S. and Strauss,L.G.
Journal Clin. Lab. 60 (2), 339-340 (2014)
Title The prognostic role of interleukin-8 (IL-8) and matrix metalloproteinases -2 and -9 in lymph node-negative untreated breast cancer patients .
Author Milovanovic J, Todorovic-Rakovic N and Abu Rabi Z.
Journal J BUON 18 (4), 866-873 (2013)
Title Interleukin-8 as a macrophage-derived mediator of angiogenesis .
Author Koch AE, Polverini PJ, Kunkel SL, Harlow LA, DiPietro LA, Elner VM, Elner SG and Strieter RM.
Journal Science 258 (5089), 1798-1801 (1992)
Title Human placenta constitutively produces interleukin-8 during pregnancy and enhances its production in intrauterine infection .
Author Shimoya K, Matsuzaki N, Taniguchi T, Kameda T, Koyama M, Neki R, Saji F and Tanizawa O.
Journal Biol. Reprod. 47 (2), 220-226 (1992)
Title Interleukin-8, a chemotactic and inflammatory cytokine .
Author Baggiolini M and Clark-Lewis I.
Journal FEBS Lett. 307 (1), 97-101 (1992)
Title Structure and functional expression of a human interleukin-8 receptor .
Author Holmes WE, Lee J, Kuang WJ, Rice GC and Wood WI.
Journal Science 253 (5025), 1278-1280 (1991)
Title Selective attraction of monocytes and T lymphocytes of the memory phenotype by cytokine RANTES .
Author Schall TJ, Bacon K, Toy KJ and Goeddel DV.
Journal Nature 347 (6294), 669-671 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.