• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor (TNF), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27508 Homo sapiens tumor necrosis factor (TNF), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu27508C Homo sapiens tumor necrosis factor (TNF), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000594.3, 395132451
Length 702 bp
Structure linear
Update Date 26-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor (TNF), mRNA.
Product tumor necrosis factor
Comment

Summary: This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. [provided by RefSeq, Jul 2008].

RefSeq NP_000585.2
CDS 176..877
Misc Feature(1)98..100
Misc Feature(2)179..181
Misc Feature(3)179..181
Misc Feature(4)230..232
Misc Feature(5)233..235
Misc Feature(6)278..283
Misc Feature(7)281..343
Misc Feature(8)290..295
Misc Feature(9)320..325
Misc Feature(10)326..331
Misc Feature(11)395..397
Misc Feature(12)395..397
Misc Feature(13)395..397
Misc Feature(14)401..406
Misc Feature(15)401..403
Misc Feature(16)401..403
Misc Feature(17)410..412
Misc Feature(18)437..868
Misc Feature(19)order(446..448,572..574,578..580,758..760,773..775,
Misc Feature(20)order(488..493,506..508,632..634,653..655,668..670)
Exon (1)1..361
Gene:TNF
Gene Synonym:DIF; TNF-alpha; TNFA; TNFSF2
Exon (2)362..407
Gene:TNF
Gene Synonym:DIF; TNF-alpha; TNFA; TNFSF2
Exon (3)408..455
Gene:TNF
Gene Synonym:DIF; TNF-alpha; TNFA; TNFSF2
Exon (4)456..1676
Gene:TNF
Gene Synonym:DIF; TNF-alpha; TNFA; TNFSF2
Translation MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
5+dbSNP:
5+c, tdbSNP:4248164
31+a, gdbSNP:61761335
39..40+, agdbSNP:4647199
61..62+, cdbSNP:201328097
62..63+, cdbSNP:4645838
63+c, gdbSNP:3093660
68..69+, cdbSNP:386594198
133+a, tdbSNP:372568141
146+c, tdbSNP:372719825
148+a, gdbSNP:386568594
complement(148)-g, adbSNP:2515924
170+a, gdbSNP:375864945
177+c, tdbSNP:369780852
197+c, tdbSNP:374531985
198+a, gdbSNP:201502336
202+c, tdbSNP:377627218
223+a, gdbSNP:146375573
231+a, gdbSNP:377338702
262+g, tdbSNP:2228088
295+c, tdbSNP:141667614
304+c, tdbSNP:369163834
312+c, tdbSNP:200241887
313+a, gdbSNP:144480538
329+a, cdbSNP:3179060
366+dbSNP:
366+c, tdbSNP:35131721
413+c, tdbSNP:369783162
426+c, tdbSNP:4645843
435+a, cdbSNP:190788828
455+a, gdbSNP:1800620
467+dbSNP:
467+a, gdbSNP:375472217
481+c, tdbSNP:1800618
497+c, tdbSNP:281865419
520+c, tdbSNP:142488339
565+c, tdbSNP:150508976
648+a, gdbSNP:369510319
656+g, tdbSNP:373646181
717+a, cdbSNP:140654183
752+c, tdbSNP:180710258
756+a, tdbSNP:11574936
795+a, gdbSNP:376368223
815+c, tdbSNP:141307820
821+g, tdbSNP:370893734
851+a, gdbSNP:186486397
881+a, gdbSNP:190947828
905+c, tdbSNP:372252268
954+a, cdbSNP:3093665
1111+c, tdbSNP:4645845
1193..1194+c, tdbSNP:79207063
1194+c, tdbSNP:10947218
1255+, tdbSNP:55691552
1296+c, tdbSNP:3093666
1330+g, tdbSNP:3093667
1391+g, tdbSNP:28501663
1486+a, tdbSNP:55788986
1577+a, cdbSNP:191617007
Gene SymbolTNF
Gene SynonymDIF; TNF-alpha; TNFA; TNFSF2
Chromosome6
Locus Map6p21.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000594 Homo sapiens tumor necrosis factor (TNF), mRNA. In-stock $99.00 5-7
Title Sine oculis homeobox homolog 1 promotes alpha5beta1-mediated invasive migration and metastasis of cervical cancer cells .
Author Liu D, Zhang XX, Wan DY, Xi BX, Ma D, Wang H and Gao QL.
Journal Biochem. Biophys. Res. Commun. 446 (2), 549-554 (2014)
Title Lack of association between TNF-alpha promoter polymorphism and prostate carcinoma susceptibility in eastern Croatian population .
Author Horvat V, Sudarevic B, Cosic I, Milicevic N, Bosnjak S, Mandic S, Marczi S, Simunovic D and Galic J.
Journal Coll Antropol 37 (4), 1199-1202 (2013)
Title CTLA-4 +49 and TNF-alpha-308 gene polymorphisms in celiac patients with exocrine pancreatic insufficiency .
Author Licul V, Cizmarevic NS, Ristic S, Mikolasevic I and Mijandrusic BS.
Journal Coll Antropol 37 (4), 1191-1194 (2013)
Title Polymorphisms of the IL12B, IL1B, and TNFA genes and susceptibility to asthma .
Author Padron-Morales,J., Sanz,C., Davila,I., Munoz-Bellido,F., Lorente,F. and Isidoro-Garcia,M.
Journal J Investig Allergol Clin Immunol 23 (7), 487-494 (2013)
Title Single-nucleotide polymorphisms of TNFA and IL1 in allergic rhinitis .
Author Nasiri,R., Amirzargar,A.A., Movahedi,M., Hirbod-Mobarakeh,A., Farhadi,E., Behniafard,N., Tavakkol,M., Ansaripour,B., Moradi,B., Zare,A. and Rezaei,N.
Journal J Investig Allergol Clin Immunol 23 (7), 455-461 (2013)
Title Effects of the human immunodeficiency virus type 1 Tat protein on the expression of inflammatory cytokines .
Author Buonaguro L, Barillari G, Chang HK, Bohan CA, Kao V, Morgan R, Gallo RC and Ensoli B.
Journal J. Virol. 66 (12), 7159-7167 (1992)
Title Site-directed mutational analysis of human tumor necrosis factor-alpha receptor binding site and structure-functional relationship .
Author Zhang XM, Weber I and Chen MJ.
Journal J. Biol. Chem. 267 (33), 24069-24075 (1992)
Title Myristyl acylation of the tumor necrosis factor alpha precursor on specific lysine residues .
Author Stevenson FT, Bursten SL, Locksley RM and Lovett DH.
Journal J. Exp. Med. 176 (4), 1053-1062 (1992)
Title Genomic structure, induction, and production of TNF-alpha .
Author Spriggs DR, Deutsch S and Kufe DW.
Journal Immunol. Ser. 56, 3-34 (1992)
Title Tumor necrosis factor-alpha induces vitamin D-1-hydroxylase activity in normal human alveolar macrophages .
Author Pryke AM, Duggan C, White CP, Posen S and Mason RS.
Journal J. Cell. Physiol. 142 (3), 652-656 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.