• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tumor necrosis factor (TNF), mRNA.


RefSeq Accession Definition Services Price Order
NM_000594 Homo sapiens tumor necrosis factor (TNF), mRNA. ORF Sequence $203.58
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000594.3, 395132451
Length 1686 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tumor necrosis factor (TNF), mRNA.
Product tumor necrosis factor
Comment

Summary: This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. [provided by RefSeq, Jul 2008].

RefSeq NP_000585.2
CDS 176..877
Misc Feature(1)98..100
Misc Feature(2)179..181
Misc Feature(3)179..181
Misc Feature(4)230..232
Misc Feature(5)233..235
Misc Feature(6)278..283
Misc Feature(7)281..343
Misc Feature(8)290..295
Misc Feature(9)320..325
Misc Feature(10)326..331
Misc Feature(11)395..397
Misc Feature(12)395..397
Misc Feature(13)395..397
Misc Feature(14)401..406
Misc Feature(15)401..403
Misc Feature(16)401..403
Misc Feature(17)410..412
Misc Feature(18)437..868
Misc Feature(19)order(446..448,572..574,578..580,758..760,773..775,
Misc Feature(20)order(488..493,506..508,632..634,653..655,668..670)
Exon (1)1..361
Gene:TNF
Gene Synonym:DIF; TNF-alpha; TNFA; TNFSF2
Exon (2)362..407
Gene:TNF
Gene Synonym:DIF; TNF-alpha; TNFA; TNFSF2
Exon (3)408..455
Gene:TNF
Gene Synonym:DIF; TNF-alpha; TNFA; TNFSF2
Exon (4)456..1676
Gene:TNF
Gene Synonym:DIF; TNF-alpha; TNFA; TNFSF2
Translation MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
5+dbSNP:
5+c, tdbSNP:4248164
31+a, gdbSNP:61761335
39..40+, agdbSNP:4647199
61..62+, cdbSNP:201328097
62..63+, cdbSNP:4645838
63+c, gdbSNP:3093660
148+a, gdbSNP:2515924
198+a, gdbSNP:201502336
223+a, gdbSNP:146375573
262+g, tdbSNP:2228088
295+c, tdbSNP:141667614
312+c, tdbSNP:200241887
313+a, gdbSNP:144480538
329+a, cdbSNP:3179060
366+dbSNP:
366+c, tdbSNP:35131721
426+c, tdbSNP:4645843
435+a, cdbSNP:190788828
455+a, gdbSNP:1800620
481+dbSNP:
481+c, tdbSNP:1800618
497+c, tdbSNP:281865419
520+c, tdbSNP:142488339
565+c, tdbSNP:150508976
717+a, cdbSNP:140654183
721+a, cdbSNP:144500330
752+c, tdbSNP:180710258
756+a, tdbSNP:11574936
815+c, tdbSNP:141307820
851+a, gdbSNP:186486397
881+a, gdbSNP:190947828
954+a, cdbSNP:3093665
1111+c, tdbSNP:4645845
1193..1194+c, tdbSNP:79207063
1194+c, tdbSNP:10947218
1255+, tdbSNP:55691552
1296+c, tdbSNP:3093666
1330+g, tdbSNP:3093667
1391+g, tdbSNP:28501663
1486+a, tdbSNP:55788986
1577+a, cdbSNP:191617007
Gene SymbolTNF
Gene SynonymDIF; TNF-alpha; TNFA; TNFSF2
Chromosome6
Locus Map6p21.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000594 Homo sapiens tumor necrosis factor (TNF), mRNA. Full Length $488.94
ORF Sequence $203.58
Title Association of tumor necrosis factor-alpha gene G-308A polymorphism with dilated cardiomyopathy: a meta-analysis .
Author Luo,R., Li,X., Fan,X., Yuan,W. and Wu,X.
Journal DNA Cell Biol. 32 (3), 130-137 (2013)
Title Tumor necrosis factor alpha- and interleukin-1beta-dependent induction of CCL3 expression by nucleus pulposus cells promotes macrophage migration through CCR1 .
Author Wang,J., Tian,Y., Phillips,K.L., Chiverton,N., Haddock,G., Bunning,R.A., Cross,A.K., Shapiro,I.M., Le Maitre,C.L. and Risbud,M.V.
Journal Arthritis Rheum. 65 (3), 832-842 (2013)
Title Ubiquitin-specific protease 4 promotes TNF-alpha-induced apoptosis by deubiquitination of RIP1 in head and neck squamous cell carcinoma .
Author Hou,X., Wang,L., Zhang,L., Pan,X. and Zhao,W.
Journal FEBS Lett. 587 (4), 311-316 (2013)
Title The dual-specificity phosphatase DUSP14 negatively regulates tumor necrosis factor- and interleukin-1-induced nuclear factor-kappaB activation by dephosphorylating the protein kinase TAK1 .
Author Zheng,H., Li,Q., Chen,R., Zhang,J., Ran,Y., He,X., Li,S. and Shu,H.B.
Journal J. Biol. Chem. 288 (2), 819-825 (2013)
Title Differential roles of JNK, ERK1/2, and p38 mitogen-activated protein kinases on endothelial cell tissue repair functions in response to tumor necrosis factor-alpha .
Author Kanaji,N., Nelson,A., Wang,X., Sato,T., Nakanishi,M., Gunji,Y., Basma,H., Michalski,J., Farid,M., Rennard,S.I. and Liu,X.
Journal J. Vasc. Res. 50 (2), 145-156 (2013)
Title Effects of the human immunodeficiency virus type 1 Tat protein on the expression of inflammatory cytokines .
Author Buonaguro,L., Barillari,G., Chang,H.K., Bohan,C.A., Kao,V., Morgan,R., Gallo,R.C. and Ensoli,B.
Journal J. Virol. 66 (12), 7159-7167 (1992)
Title Site-directed mutational analysis of human tumor necrosis factor-alpha receptor binding site and structure-functional relationship .
Author Zhang,X.M., Weber,I. and Chen,M.J.
Journal J. Biol. Chem. 267 (33), 24069-24075 (1992)
Title Myristyl acylation of the tumor necrosis factor alpha precursor on specific lysine residues .
Author Stevenson,F.T., Bursten,S.L., Locksley,R.M. and Lovett,D.H.
Journal J. Exp. Med. 176 (4), 1053-1062 (1992)
Title Genomic structure, induction, and production of TNF-alpha .
Author Spriggs,D.R., Deutsch,S. and Kufe,D.W.
Journal Immunol. Ser. 56, 3-34 (1992)
Title Tumor necrosis factor-alpha induces vitamin D-1-hydroxylase activity in normal human alveolar macrophages .
Author Pryke,A.M., Duggan,C., White,C.P., Posen,S. and Mason,R.S.
Journal J. Cell. Physiol. 142 (3), 652-656 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878