• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 6 (interferon, beta 2) (IL6), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000600 Homo sapiens interleukin 6 (interferon, beta 2) (IL6), mRNA. GenEZ ORF Cloning In-stock $308.00 $259.00 10

*Business Day

Related Services

RefSeq Version NM_000600.3, 224831235
Length 1201 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 6 (interferon, beta 2) (IL6), mRNA.
Product interleukin-6 precursor
Comment

Summary: This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. [provided by RefSeq, Jun 2011].

RefSeq NP_000591.1
CDS 117..755
Misc Feature(1)30..32
Misc Feature(2)285..746
Misc Feature(3)order(330..332,348..350)
Misc Feature(4)333..335
Misc Feature(5)357..359
Misc Feature(6)order(417..419,447..449)
Misc Feature(7)612..614
Misc Feature(8)624..626
Misc Feature(9)627..629
Exon (1)1..135
Gene:IL6
Gene Synonym:BSF2; HGF; HSF; IFNB2; IL-6
Exon (2)136..326
Gene:IL6
Gene Synonym:BSF2; HGF; HSF; IFNB2; IL-6
Exon (3)327..440
Gene:IL6
Gene Synonym:BSF2; HGF; HSF; IFNB2; IL-6
Exon (4)441..587
Gene:IL6
Gene Synonym:BSF2; HGF; HSF; IFNB2; IL-6
Exon (5)588..1184
Gene:IL6
Gene Synonym:BSF2; HGF; HSF; IFNB2; IL-6
Translation MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
17+dbSNP:
17+a, cdbSNP:201575115
61+c, tdbSNP:199671830
67+g, tdbSNP:13306438
69+a, cdbSNP:2069857
73+a, cdbSNP:185230192
74+a, gdbSNP:199546667
84+c, gdbSNP:3087226
121+a, tdbSNP:200700194
125+c, tdbSNP:200815144
137+dbSNP:
137+a, cdbSNP:199941251
140+a, cdbSNP:200637969
158..159+, cdbSNP:34280821
176+a, gdbSNP:201852608
180+c, tdbSNP:148516576
207+a, cdbSNP:142759801
210+c, tdbSNP:2069830
220+a, tdbSNP:201787553
246+a, cdbSNP:199957016
279+a, gdbSNP:202138427
284+a, cdbSNP:199925567
290+a, gdbSNP:200999878
291+c, tdbSNP:201822486
299+c, tdbSNP:140764737
311+a, cdbSNP:201410817
329+dbSNP:
329+a, gdbSNP:145242107
332+c, tdbSNP:147625275
345+a, gdbSNP:201121373
351+c, gdbSNP:190436077
353+a, gdbSNP:200987147
356+c, tdbSNP:201523057
365+a, g, tdbSNP:142164099
376+a, gdbSNP:199990564
388+a, tdbSNP:200745306
427+a, cdbSNP:202210223
442+dbSNP:
442+a, gdbSNP:200263800
462+a, tdbSNP:148171375
472+c, tdbSNP:11544633
499+a, gdbSNP:201371019
522+a, gdbSNP:56383910
568..569+, cdbSNP:34012176
572+c, gdbSNP:182812860
575+c, tdbSNP:199569510
593+dbSNP:
593+c, gdbSNP:200477775
601+a, tdbSNP:2069860
602+a, tdbSNP:13306435
615+c, gdbSNP:200641450
620+a, c, gdbSNP:201947383
646+c, tdbSNP:148828876
665+a, cdbSNP:199857749
677+a, gdbSNP:201335041
683..684+, adbSNP:34709428
703+a, gdbSNP:143432552
716+c, gdbSNP:201777722
719+c, tdbSNP:2069849
758+c, tdbSNP:111490870
782+a, gdbSNP:201868479
786+a, gdbSNP:200852701
792+c, tdbSNP:2069850
800+c, tdbSNP:199619831
802+a, gdbSNP:41477054
805+a, tdbSNP:201107891
818+c, tdbSNP:202198528
822+c, gdbSNP:200226108
844+c, tdbSNP:201743553
847+a, gdbSNP:199652344
859+a, gdbSNP:13306436
866+c, tdbSNP:201150447
867+a, gdbSNP:2069851
890+g, tdbSNP:200697926
914+a, gdbSNP:201769340
949+a, gdbSNP:199606490
967+g, tdbSNP:55773150
981+c, gdbSNP:202045132
1005+a, cdbSNP:200126515
1039+a, gdbSNP:201131164
1091+c, tdbSNP:201722624
1095+c, tdbSNP:199889619
1115+c, tdbSNP:201176371
1119+c, tdbSNP:202085240
1135+c, tdbSNP:183160679
Gene SymbolIL6
Gene SynonymBSF2; HGF; HSF; IFNB2; IL-6
Chromosome7
Locus Map7p21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000600 Homo sapiens interleukin 6 (interferon, beta 2) (IL6), mRNA. In-stock $308.00 $259.00 10
Title The lack of association between interleukin-6 gene -174 G/C polymorphism and the risk of type 1 diabetes mellitus: a meta-analysis of 18,152 subjects .
Author Yin,Y.W., Sun,Q.Q., Zhang,B.B., Hu,A.M., Wang,Q., Liu,H.L., Hou,Z.Z., Zeng,Y.H., Xu,R.J. and Shi,L.B.
Journal Gene 515 (2), 461-465 (2013)
Title Interleukin-6 induces vascular endothelial growth factor expression and promotes angiogenesis through apoptosis signal-regulating kinase 1 in human osteosarcoma .
Author Tzeng,H.E., Tsai,C.H., Chang,Z.L., Su,C.M., Wang,S.W., Hwang,W.L. and Tang,C.H.
Journal Biochem. Pharmacol. 85 (4), 531-540 (2013)
Title Blocking A2B adenosine receptor alleviates pathogenesis of experimental autoimmune encephalomyelitis via inhibition of IL-6 production and Th17 differentiation .
Author Wei,W., Du,C., Lv,J., Zhao,G., Li,Z., Wu,Z., Hasko,G. and Xie,X.
Journal J. Immunol. 190 (1), 138-146 (2013)
Title [Role of IL-6 for the diagnosis of preterm birth] .
Author Masseva,A., Dimitrov,A., Nikolov,A., Altankona,I. and Koitcheva,N.
Journal Akush Ginekol (Sofiia) 51 (3), 9-14 (2012)
Title Cytokine induction by pyrogens: comparison of whole blood, mononuclear cells, and TLR-transfectants .
Author Kikkert,R., de Groot,E.R. and Aarden,L.A.
Journal J. Immunol. Methods 336 (1), 45-55 (2008)
Title Infection, fever, and exogenous and endogenous pyrogens: some concepts have changed .
Author Dinarello,C.A.
Journal J. Endotoxin Res. 10 (4), 201-222 (2004)
Title [Stable and efficient expression of human interleukin-6 cDNA in mammalian cells after gene transfer] .
Author Chen,Q.Y.
Journal Zhonghua Zhong Liu Za Zhi 14 (5), 340-344 (1992)
Title Phosphorylation of interleukin-6 at serine54: an early event in the secretory pathway in human fibroblasts .
Author May,L.T. and Sehgal,P.B.
Journal Biochem. Biophys. Res. Commun. 185 (2), 524-530 (1992)
Title Marked cell-type-specific differences in glycosylation of human interleukin-6 .
Author May,L.T., Shaw,J.E., Khanna,A.K., Zabriskie,J.B. and Sehgal,P.B.
Journal Cytokine 3 (3), 204-211 (1991)
Title A case of meningitis admitted as schizophrenia .
Author Sandler,N.H.
Journal J Ky Med Assoc 73 (1), 25-26 (1975)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.