• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25775 Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu25775C Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000601.4, 58533168
Length 2187 bp
Structure linear
Update Date 24-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA.
Product hepatocyte growth factor isoform 1 preproprotein
Comment

Summary: Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longest isoform (1). To date, experimental evidence for cleavage of the proprotein into two mature chains has been shown only for isoform 1.

RefSeq NP_000592.3
CDS 166..2352
Misc Feature(1)58..60
Misc Feature(2)259..261
Misc Feature(3)280..531
Misc Feature(4)order(343..345,349..351,382..384)
Misc Feature(5)541..786
Misc Feature(6)574..576
Misc Feature(7)order(619..621,649..651,727..729,733..735,757..759)
Misc Feature(8)787..1032
Misc Feature(9)823..825
Misc Feature(10)order(868..870,898..900,973..975,979..981,1003..1005)
Misc Feature(11)1069..1317
Misc Feature(12)1105..1107
Misc Feature(13)order(1150..1152,1180..1182,1255..1257,1261..1263,
Misc Feature(14)1327..1575
Misc Feature(15)1363..1365
Misc Feature(16)order(1408..1410,1438..1440,1516..1518,1522..1524,
Misc Feature(17)1435..1437
Misc Feature(18)1435..1437
Misc Feature(19)1645..2313
Misc Feature(20)1645..1647
Misc Feature(21)1645..1647
Misc Feature(22)1645..1647
Misc Feature(23)1648..2322
Misc Feature(24)1648..1650
Misc Feature(25)order(1765..1767,1897..1899,2182..2184)
Misc Feature(26)order(2164..2166,2239..2241,2245..2247)
Exon (1)1..253
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (2)254..419
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (3)420..532
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (4)533..647
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (5)648..790
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (6)791..911
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (7)912..1030
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (8)1031..1205
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (9)1206..1333
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (10)1334..1436
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (11)1437..1570
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (12)1571..1609
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (13)1610..1706
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (14)1707..1781
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (15)1782..1922
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (16)1923..2029
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (17)2030..2175
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (18)2176..2805
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Translation MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGS ESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL DHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD LKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII LTYKVPQS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(24)-dbSNP:
complement(24)-g, cdbSNP:371718041
complement(66)-t, gdbSNP:76382276
complement(72)-t, gdbSNP:386599730
72+g, tdbSNP:5745609
complement(126)-t, adbSNP:28719812
complement(151)-g, adbSNP:370842395
complement(152)-g, cdbSNP:201598927
complement(169)-g, adbSNP:375901177
complement(192)-g, adbSNP:372751973
complement(213)-g, adbSNP:148935472
complement(227)-g, adbSNP:370490787
complement(286)-dbSNP:
complement(286)-t, cdbSNP:376573289
complement(294)-t, cdbSNP:17855203
complement(302)-g, adbSNP:150267054
complement(311)-t, gdbSNP:368094683
complement(347)-t, gdbSNP:142659098
complement(348)-g, adbSNP:147718886
complement(381)-g, adbSNP:372588506
complement(423)-dbSNP:
complement(423)-g, adbSNP:370202240
complement(435)-g, adbSNP:145598174
complement(443)-g, cdbSNP:189052337
complement(462)-g, adbSNP:368633795
complement(498)-g, adbSNP:5745635
complement(512)-t, adbSNP:151170133
complement(554)-dbSNP:
complement(554)-g, adbSNP:141389863
623+g, tdbSNP:17566
complement(636)-t, cdbSNP:142045938
complement(639)-g, adbSNP:367553438
complement(659)-dbSNP:
complement(659)-g, adbSNP:370760302
660+a, gdbSNP:137853235
complement(662)-t, cdbSNP:373660832
complement(689)-t, cdbSNP:73381183
complement(743)-t, cdbSNP:148615168
complement(759)-g, adbSNP:143891160
complement(785)-g, adbSNP:377663087
complement(803)-dbSNP:
complement(803)-g, cdbSNP:144136982
complement(824)-t, cdbSNP:372600489
complement(847)-c, adbSNP:139457161
complement(876)-t, cdbSNP:5745666
complement(889)-g, adbSNP:202185530
complement(890)-t, cdbSNP:200559590
complement(945)-dbSNP:
complement(945)-g, adbSNP:375177081
complement(954)-g, adbSNP:147312555
complement(1001)-c, adbSNP:371502313
complement(1026)-t, cdbSNP:368002816
complement(1029)-g, adbSNP:374136304
complement(1048)-dbSNP:
complement(1048)-g, cdbSNP:367811213
complement(1050)-g, adbSNP:141751290
complement(1075)-g, adbSNP:5745687
complement(1075)-g, adbSNP:386599734
complement(1148)-t, cdbSNP:374484762
complement(1153)-t, gdbSNP:5745688
complement(1153)-c, adbSNP:386599735
complement(1173)-t, cdbSNP:148714837
complement(1213)-dbSNP:
complement(1213)-t, gdbSNP:373442319
complement(1238)-t, cdbSNP:184858341
1256+a, gdbSNP:5745703
complement(1256)-t, cdbSNP:386599738
complement(1293)-g, adbSNP:112557787
complement(1300)-t, gdbSNP:200948659
complement(1344)-dbSNP:
complement(1344)-g, adbSNP:377036882
complement(1395)-t, cdbSNP:373298029
complement(1456)-dbSNP:
complement(1456)-g, cdbSNP:61735997
complement(1561)-t, adbSNP:141487191
complement(1568)-t, cdbSNP:148293411
complement(1614)-dbSNP:
complement(1614)-g, adbSNP:375872396
1619+c, tdbSNP:397516446
complement(1631)-t, cdbSNP:371520373
complement(1635)-t, cdbSNP:372075114
complement(1686)-t, cdbSNP:200549396
complement(1743)-dbSNP:
complement(1743)-g, cdbSNP:143262934
complement(1779)-t, adbSNP:368519009
complement(1814)-dbSNP:
complement(1814)-t, adbSNP:192078086
complement(1827)-g, adbSNP:148098479
complement(1837)-t, cdbSNP:370757602
complement(1839)-g, adbSNP:144086354
complement(1852)-g, cdbSNP:376043671
complement(1869)-g, adbSNP:138548003
complement(1911)-t, cdbSNP:201395847
complement(1938)-dbSNP:
complement(1938)-g, adbSNP:199516810
complement(1979)-g, adbSNP:147075806
complement(1997)-g, cdbSNP:141774517
complement(2022)-g, adbSNP:200374420
complement(2031)-dbSNP:
complement(2031)-t, cdbSNP:376395424
complement(2032)-t, cdbSNP:371826587
complement(2037)-g, adbSNP:373545882
complement(2056)-t, cdbSNP:145494248
complement(2099)-t, cdbSNP:202215700
complement(2107)-t, cdbSNP:150109563
complement(2109)-t, cdbSNP:369418750
complement(2184)-dbSNP:
complement(2184)-g, adbSNP:367800414
complement(2260)-t, cdbSNP:372366408
complement(2287)-g, adbSNP:201768315
complement(2295)-t, gdbSNP:267601578
complement(2344)-g, adbSNP:140790665
complement(2392)-g, adbSNP:377185441
complement(2454..2455)-, agttdbSNP:374789745
complement(2654)-t, adbSNP:186434043
complement(2748)-t, adbSNP:182057547
Gene SymbolHGF
Gene SynonymDFNB39; F-TCF; HGFB; HPTA; SF
Chromosome7
Locus Map7q21.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000601 Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_000601 Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_000601 Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_000601 Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_000601 Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_000601 Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA. On-demand $279.00 12-14
Title The involvement of the docking protein Gab1 in mitogenic signalling induced by EGF and HGF in rat hepatocytes .
Author Aasrum M, Odegard J, Sandnes D and Christoffersen T.
Journal Biochim. Biophys. Acta 1833 (12), 3286-3294 (2013)
Title Paracrine activation of MET promotes peritoneal carcinomatosis in scirrhous gastric cancer .
Author Zhao L, Yasumoto K, Kawashima A, Nakagawa T, Takeuchi S, Yamada T, Matsumoto K, Yonekura K, Yoshie O and Yano S.
Journal Cancer Sci. 104 (12), 1640-1646 (2013)
Title Pancreatic beta cell proliferation by intermittent hypoxia via up-regulation of Reg family genes and HGF gene .
Author Ota H, Itaya-Hironaka A, Yamauchi A, Sakuramoto-Tsuchida S, Miyaoka T, Fujimura T, Tsujinaka H, Yoshimoto K, Nakagawara K, Tamaki S, Takasawa S and Kimura H.
Journal Life Sci. 93 (18-19), 664-672 (2013)
Title Regulatory expression of MMP-8/MMP-9 and inhibition of proliferation, migration and invasion in human lung cancer A549 cells in the presence of HGF variants .
Author Ramanujum R, Lin YL, Liu JK and He S.
Journal Kaohsiung J. Med. Sci. 29 (10), 530-539 (2013)
Title Hepatic stellate cells secreted hepatocyte growth factor contributes to the chemoresistance of hepatocellular carcinoma .
Author Yu G, Jing Y, Kou X, Ye F, Gao L, Fan Q, Yang Y, Zhao Q, Li R, Wu M and Wei L.
Journal PLoS ONE 8 (9), E73312 (2013)
Title Deafness and Hereditary Hearing Loss Overview .
Author Smith,R.J.H., Shearer,A.E., Hildebrand,M.S. and Van Camp,G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title A functional domain in the heavy chain of scatter factor/hepatocyte growth factor binds the c-Met receptor and induces cell dissociation but not mitogenesis .
Author Hartmann G, Naldini L, Weidner KM, Sachs M, Vigna E, Comoglio PM and Birchmeier W.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (23), 11574-11578 (1992)
Title Extracellular proteolytic cleavage by urokinase is required for activation of hepatocyte growth factor/scatter factor .
Author Naldini L, Tamagnone L, Vigna E, Sachs M, Hartmann G, Birchmeier W, Daikuhara Y, Tsubouchi H, Blasi F and Comoglio PM.
Journal EMBO J. 11 (13), 4825-4833 (1992)
Title Activation of hepatocyte growth factor by proteolytic conversion of a single chain form to a heterodimer .
Author Naka D, Ishii T, Yoshiyama Y, Miyazawa K, Hara H, Hishida T and Kidamura N.
Journal J. Biol. Chem. 267 (28), 20114-20119 (1992)
Title Structure-function analysis of hepatocyte growth factor: identification of variants that lack mitogenic activity yet retain high affinity receptor binding .
Author Lokker NA, Mark MR, Luis EA, Bennett GL, Robbins KA, Baker JB and Godowski PJ.
Journal EMBO J. 11 (7), 2503-2510 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.