• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000601 Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_000601.4, 58533168
Length 2820 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA.
Product hepatocyte growth factor isoform 1 preproprotein
Comment

Summary: Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longest isoform (1). To date, experimental evidence for cleavage of the proprotein into two mature chains has been shown only for isoform 1.

RefSeq NP_000592.3
CDS 166..2352
Misc Feature(1)58..60
Misc Feature(2)58..60
Misc Feature(3)259..261
Misc Feature(4)280..531
Misc Feature(5)order(343..345,349..351,382..384)
Misc Feature(6)541..786
Misc Feature(7)574..576
Misc Feature(8)order(619..621,649..651,727..729,733..735,757..759)
Misc Feature(9)787..1032
Misc Feature(10)823..825
Misc Feature(11)order(868..870,898..900,973..975,979..981,1003..1005)
Misc Feature(12)1069..1317
Misc Feature(13)1105..1107
Misc Feature(14)order(1150..1152,1180..1182,1255..1257,1261..1263,
Misc Feature(15)1327..1575
Misc Feature(16)1363..1365
Misc Feature(17)order(1408..1410,1438..1440,1516..1518,1522..1524,
Misc Feature(18)1435..1437
Misc Feature(19)1435..1437
Misc Feature(20)1645..1647
Misc Feature(21)1645..1647
Misc Feature(22)1645..1647
Misc Feature(23)1648..2322
Misc Feature(24)1648..1650
Misc Feature(25)order(1765..1767,1897..1899,2182..2184)
Misc Feature(26)order(2164..2166,2239..2241,2245..2247)
Exon (1)1..253
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (2)254..419
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (3)420..532
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (4)533..647
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (5)648..790
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (6)791..911
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (7)912..1030
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (8)1031..1205
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (9)1206..1333
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (10)1334..1436
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (11)1437..1570
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (12)1571..1609
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (13)1610..1706
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (14)1707..1781
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (15)1782..1922
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (16)1923..2029
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (17)2030..2175
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Exon (18)2176..2805
Gene:HGF
Gene Synonym:DFNB39; F-TCF; HGFB; HPTA; SF
Translation MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGS ESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL DHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD LKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII LTYKVPQS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(66)-t, gdbSNP:76382276
complement(72)-t, gdbSNP:5745609
complement(126)-t, adbSNP:28719812
complement(152)-g, cdbSNP:201598927
complement(213)-g, adbSNP:148935472
complement(293)-dbSNP:
complement(293)-t, cdbSNP:138927646
complement(294)-t, cdbSNP:17855203
complement(302)-g, adbSNP:150267054
complement(347)-t, gdbSNP:142659098
complement(348)-g, adbSNP:147718886
complement(435)-dbSNP:
complement(435)-g, adbSNP:145598174
complement(443)-g, cdbSNP:189052337
complement(498)-g, adbSNP:5745635
complement(512)-t, adbSNP:151170133
complement(554)-dbSNP:
complement(554)-g, adbSNP:141389863
complement(623)-t, gdbSNP:17566
complement(636)-t, cdbSNP:142045938
complement(660)-dbSNP:
complement(660)-g, adbSNP:137853235
complement(689)-t, cdbSNP:73381183
complement(743)-t, cdbSNP:148615168
complement(759)-g, adbSNP:143891160
complement(803)-dbSNP:
complement(803)-g, cdbSNP:144136982
complement(847)-c, adbSNP:139457161
complement(876)-t, cdbSNP:5745666
complement(889)-g, adbSNP:202185530
complement(890)-t, cdbSNP:200559590
complement(954)-dbSNP:
complement(954)-g, adbSNP:147312555
complement(1050)-dbSNP:
complement(1050)-g, adbSNP:141751290
complement(1075)-g, adbSNP:5745687
complement(1153)-t, gdbSNP:5745688
complement(1173)-t, cdbSNP:148714837
complement(1238)-dbSNP:
complement(1238)-t, cdbSNP:184858341
complement(1256)-g, adbSNP:5745703
complement(1293)-g, adbSNP:112557787
complement(1300)-t, gdbSNP:200948659
complement(1456)-dbSNP:
complement(1456)-g, cdbSNP:61735997
complement(1561)-t, adbSNP:141487191
complement(1568)-t, cdbSNP:148293411
complement(1686)-dbSNP:
complement(1686)-t, cdbSNP:200549396
complement(1743)-dbSNP:
complement(1743)-g, cdbSNP:143262934
complement(1814)-dbSNP:
complement(1814)-t, adbSNP:192078086
complement(1827)-g, adbSNP:148098479
complement(1839)-g, adbSNP:144086354
complement(1869)-g, adbSNP:138548003
complement(1911)-t, cdbSNP:201395847
complement(1938)-dbSNP:
complement(1938)-g, adbSNP:199516810
complement(1979)-g, adbSNP:147075806
complement(1997)-g, cdbSNP:141774517
complement(2022)-g, adbSNP:200374420
complement(2056)-dbSNP:
complement(2056)-t, cdbSNP:145494248
complement(2099)-t, cdbSNP:202215700
complement(2107)-t, cdbSNP:150109563
complement(2287)-dbSNP:
complement(2287)-g, adbSNP:201768315
complement(2344)-g, adbSNP:140790665
complement(2654)-t, adbSNP:186434043
complement(2748)-t, adbSNP:182057547
Gene SymbolHGF
Gene SynonymDFNB39; F-TCF; HGFB; HPTA; SF
Chromosome7
Locus Map7q21.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000601 Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 1, mRNA. On-demand $849.00 20
NM_001010931 Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 2, mRNA. On-demand $449.00 14
NM_001010932 Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 3, mRNA. On-demand $849.00 20
NM_001010933 Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 4, mRNA. On-demand $449.00 14
NM_001010934 Homo sapiens hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 5, mRNA. On-demand $399.00 14
Title Analysis of stromal cell secretomes reveals a critical role for stromal cell-derived hepatocyte growth factor and fibronectin in angiogenesis .
Author Newman,A.C., Chou,W., Welch-Reardon,K.M., Fong,A.H., Popson,S.A., Phan,D.T., Sandoval,D.R., Nguyen,D.P., Gershon,P.D. and Hughes,C.C.
Journal Arterioscler. Thromb. Vasc. Biol. 33 (3), 513-522 (2013)
Title Critical role of S1PR1 and integrin beta4 in HGF/c-Met-mediated increases in vascular integrity .
Author Ephstein,Y., Singleton,P.A., Chen,W., Wang,L., Salgia,R., Kanteti,P., Dudek,S.M., Garcia,J.G. and Jacobson,J.R.
Journal J. Biol. Chem. 288 (4), 2191-2200 (2013)
Title Multiple angiogenetic factors are upregulated in POEMS syndrome .
Author Yamada,Y., Sawai,S., Misawa,S., Kanai,K., Shibuya,K., Mori,M., Moriya,J., Sogawa,K., Yamamoto,H., Beppu,M., Taniguchi,J., Nakaseko,C., Nomura,F. and Kuwabara,S.
Journal Ann. Hematol. 92 (2), 245-248 (2013)
Title Changes in circulating pro-angiogenic cytokines, other than VEGF, before progression to sunitinib therapy in advanced renal cell carcinoma patients .
Author Porta,C., Paglino,C., Imarisio,I., Ganini,C., Sacchi,L., Quaglini,S., Giunta,V. and De Amici,M.
Journal Oncology 84 (2), 115-122 (2013)
Title Role of hepatocyte growth factor in promoting the growth of human corneal endothelial cells stimulated by L-ascorbic acid 2-phosphate .
Author Kimoto,M., Shima,N., Yamaguchi,M., Amano,S. and Yamagami,S.
Journal Invest. Ophthalmol. Vis. Sci. 53 (12), 7583-7589 (2012)
Title A functional domain in the heavy chain of scatter factor/hepatocyte growth factor binds the c-Met receptor and induces cell dissociation but not mitogenesis .
Author Hartmann,G., Naldini,L., Weidner,K.M., Sachs,M., Vigna,E., Comoglio,P.M. and Birchmeier,W.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (23), 11574-11578 (1992)
Title Extracellular proteolytic cleavage by urokinase is required for activation of hepatocyte growth factor/scatter factor .
Author Naldini,L., Tamagnone,L., Vigna,E., Sachs,M., Hartmann,G., Birchmeier,W., Daikuhara,Y., Tsubouchi,H., Blasi,F. and Comoglio,P.M.
Journal EMBO J. 11 (13), 4825-4833 (1992)
Title Activation of hepatocyte growth factor by proteolytic conversion of a single chain form to a heterodimer .
Author Naka,D., Ishii,T., Yoshiyama,Y., Miyazawa,K., Hara,H., Hishida,T. and Kidamura,N.
Journal J. Biol. Chem. 267 (28), 20114-20119 (1992)
Title Regional mapping of the human hepatocyte growth factor (HGF)-scatter factor gene to chromosome 7q21.1 .
Author Saccone,S., Narsimhan,R.P., Gaudino,G., Dalpra,L., Comoglio,P.M. and Della Valle,G.
Journal Genomics 13 (3), 912-914 (1992)
Title Structure-function analysis of hepatocyte growth factor: identification of variants that lack mitogenic activity yet retain high affinity receptor binding .
Author Lokker,N.A., Mark,M.R., Luis,E.A., Bennett,G.L., Robbins,K.A., Baker,J.B. and Godowski,P.J.
Journal EMBO J. 11 (7), 2503-2510 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.