• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens neural cell adhesion molecule 1 (NCAM1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000615 Homo sapiens neural cell adhesion molecule 1 (NCAM1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_000615.6, 336285433
Length 5977 bp
Structure linear
Update Date 20-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens neural cell adhesion molecule 1 (NCAM1), transcript variant 1, mRNA.
Product neural cell adhesion molecule 1 isoform 1 precursor
Comment

Summary: This gene encodes a cell adhesion protein which is a member of the immunoglobulin superfamily. The encoded protein is involved in cell-to-cell interactions as well as cell-matrix interactions during development and differentiation. The encoded protein has been shown to be involved in development of the nervous system, and for cells involved in the expansion of T cells and dendritic cells which play an important role in immune surveillance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2011].


Transcript Variant: This variant (1) lacks two alternate in-frame exons in the 3' coding region compared to variant 5. The resulting protein (isoform 1) is shorter compared to isoform 5.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000606.3
CDS 367..2913
Misc Feature(1)424..711
Misc Feature(2)427..702
Misc Feature(3)order(469..471,475..480)
Misc Feature(4)769..936
Misc Feature(5)997..1287
Misc Feature(6)1030..1278
Misc Feature(7)1282..1572
Misc Feature(8)1630..1842
Misc Feature(9)1711..1713
Misc Feature(10)1798..1800
Misc Feature(11)1858..2151
Misc Feature(12)order(2068..2070,2113..2115)
Misc Feature(13)order(2116..2121,2125..2130)
Misc Feature(14)2170..2433
Misc Feature(15)order(2170..2172,2362..2364,2407..2409)
Misc Feature(16)order(2410..2415,2419..2424)
Misc Feature(17)2491..2553
Exon (1)1..418
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (2)419..493
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (3)494..712
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (4)713..856
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (5)857..994
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (6)995..1112
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (7)1113..1282
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (8)1283..1425
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (9)1426..1576
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (10)1577..1761
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (11)1762..1858
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (12)1859..2029
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (13)2030..2161
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (14)2162..2164
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (15)2165..2289
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (16)2290..2467
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (17)2468..2675
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (18)2676..2792
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (19)2793..5962
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Translation MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE KLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMF KNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGF PEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATI HLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMV VRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGN QVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCT AVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAV GEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVQG EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVM LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLSTGAIVGILIV IFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFSKDESKEPIVE VRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQ TKENESKA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
78+dbSNP:
78+c, gdbSNP:7938749
80+c, tdbSNP:139414593
81+c, tdbSNP:142518273
149..150+, cdbSNP:34274345
203+g, tdbSNP:201971024
308..309+, gdbSNP:145493999
313+g, tdbSNP:199895300
331+c, tdbSNP:201206514
337..338+, adbSNP:11381910
341..342+, adbSNP:57606051
372+, gdbSNP:201772924
373+a, cdbSNP:112306738
373+, cdbSNP:11284059
385+c, tdbSNP:7105734
390+c, tdbSNP:6589347
402+a, tdbSNP:201161826
489+dbSNP:
489+c, tdbSNP:45561332
633+dbSNP:
633+c, tdbSNP:200538356
688+a, gdbSNP:188950571
699+c, tdbSNP:181729481
732+dbSNP:
732+c, tdbSNP:191287596
772+a, gdbSNP:200921858
896+dbSNP:
896+a, gdbSNP:35576001
1036+dbSNP:
1036+a, cdbSNP:199787286
1047+c, tdbSNP:17115154
1059+c, tdbSNP:17115156
1144+dbSNP:
1144+a, gdbSNP:17115160
1209+c, tdbSNP:139279798
1218+a, gdbSNP:17115163
1221+c, tdbSNP:144643875
1414+dbSNP:
1414+a, gdbSNP:201693511
1416+c, tdbSNP:34941275
1417+a, gdbSNP:185400485
1503+dbSNP:
1503+c, tdbSNP:35123203
1506+c, tdbSNP:190468342
1507+c, gdbSNP:55757519
1510+g, tdbSNP:56107970
1730+dbSNP:
1730+a, tdbSNP:200123115
1754+a, cdbSNP:186683121
1986+dbSNP:
1986+a, cdbSNP:584427
2055+dbSNP:
2055+a, gdbSNP:17115214
2056+a, gdbSNP:201325353
2064+a, gdbSNP:141690701
2070+c, tdbSNP:78645852
2082+c, tdbSNP:3741072
2085+c, tdbSNP:200726533
2100+a, gdbSNP:201910908
2130+c, tdbSNP:199567425
2132+c, tdbSNP:117485712
2288+dbSNP:
2288+c, tdbSNP:201635814
2325+dbSNP:
2325+a, gdbSNP:181774525
2340+c, tdbSNP:201880501
2373+g, tdbSNP:17115280
2430+g, tdbSNP:200953789
2482+dbSNP:
2482+a, cdbSNP:201796555
2483+c, gdbSNP:201646237
2499+c, tdbSNP:35515801
2556+c, tdbSNP:201927228
2604+a, gdbSNP:186731793
2631+c, tdbSNP:200353961
2634+a, gdbSNP:76495917
2697+dbSNP:
2697+c, tdbSNP:202190916
2726+a, gdbSNP:141580143
2766+c, tdbSNP:200459186
2775+a, gdbSNP:201752786
2837+dbSNP:
2837+a, gdbSNP:17174409
2903+a, gdbSNP:17854434
2975+, tdbSNP:60495668
2999+c, tdbSNP:192793968
3005+c, gdbSNP:1057924
3040+c, tdbSNP:142009888
3160+a, gdbSNP:112708952
3195+c, tdbSNP:140960623
3198..3199+, gdbSNP:35983476
3394+a, gdbSNP:144703582
3533+c, gdbSNP:17174410
3558+c, tdbSNP:185536769
3589+c, tdbSNP:635903
3681+a, gdbSNP:12275130
3708+a, tdbSNP:190740642
3717+a, gdbSNP:140002200
3818+a, tdbSNP:181669390
3820+c, tdbSNP:149972999
3822+c, tdbSNP:75175317
3838+c, tdbSNP:189146374
3929+c, gdbSNP:75854397
3938+c, tdbSNP:181105924
3979+c, tdbSNP:145196484
4014+g, tdbSNP:185747842
4196+c, tdbSNP:200617376
4355+a, gdbSNP:188258623
4361..4362+, gdbSNP:201011708
4361+a, gdbSNP:7927511
4363+c, gdbSNP:7927811
4427+c, tdbSNP:113237045
4584+a, gdbSNP:148902519
4682+c, tdbSNP:115020540
4780+c, gdbSNP:187112956
4799+c, tdbSNP:143624850
4900+c, tdbSNP:146482354
4918+c, gdbSNP:11547504
4959+g, tdbSNP:117166580
4980+a, gdbSNP:111287313
4997+c, tdbSNP:144802378
5031+a, gdbSNP:111990038
5040+c, tdbSNP:138566380
5169+c, gdbSNP:74800806
5279+c, tdbSNP:12278611
5281+c, tdbSNP:12278614
5296+a, cdbSNP:12291713
5340+c, tdbSNP:192443926
5351+c, tdbSNP:12278666
5372..5373+, taaadbSNP:151080039
5375..5376+, taaadbSNP:56324717
5376..5377+, aaadbSNP:10684112
5376+a, tdbSNP:12793334
5403..5404+, aa, aaadbSNP:34220014
5403+c, tdbSNP:201678929
5436+c, tdbSNP:114476800
5473+g, tdbSNP:141207290
5487..5488+, ttcdbSNP:202178980
5564+g, tdbSNP:183948283
5592..5593+, aagtdbSNP:142769829
5688+a, gdbSNP:117323688
5707+a, gdbSNP:185681645
5905+a, tdbSNP:9289
Gene SymbolNCAM1
Gene SynonymCD56; MSK39; NCAM
Chromosome11
Locus Map11q23.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000615 Homo sapiens neural cell adhesion molecule 1 (NCAM1), transcript variant 1, mRNA. On-demand $899.00 20
NM_001076682 Homo sapiens neural cell adhesion molecule 1 (NCAM1), transcript variant 3, mRNA. On-demand $849.00 20
NM_001242607 Homo sapiens neural cell adhesion molecule 1 (NCAM1), transcript variant 5, mRNA. On-demand $899.00 20
NM_001242608 Homo sapiens neural cell adhesion molecule 1 (NCAM1), transcript variant 4, mRNA. On-demand $849.00 20
NM_181351 Homo sapiens neural cell adhesion molecule 1 (NCAM1), transcript variant 2, mRNA. On-demand $899.00 20
Title The influence of neural cell adhesion molecule isoform 140 on the metastasis of thyroid carcinoma .
Author Yang,A.H., Chau,Y.P., Lee,C.H., Chen,J.Y., Chen,J.Y., Ke,C.C. and Liu,R.S.
Journal Clin. Exp. Metastasis 30 (3), 299-307 (2013)
Title UCHL1 regulates ubiquitination and recycling of the neural cell adhesion molecule NCAM .
Author Wobst,H., Forster,S., Laurini,C., Sekulla,A., Dreiseidler,M., Hohfeld,J., Schmitz,B. and Diestel,S.
Journal FEBS J. 279 (23), 4398-4409 (2012)
Title Transforming growth factor-beta1 induces microvascular abnormalities through a down-modulation of neural cell adhesion molecule in human hepatocellular carcinoma .
Author Balzarini,P., Benetti,A., Invernici,G., Cristini,S., Zicari,S., Caruso,A., Gatta,L.B., Berenzi,A., Imberti,L., Zanotti,C., Portolani,N., Giulini,S.M., Ferrari,M., Ciusani,E., Navone,S.E., Canazza,A., Parati,E.A. and Alessandri,G.
Journal Lab. Invest. 92 (9), 1297-1309 (2012)
Title CD56+ T cells inhibit HIV-1 infection of macrophages .
Author Hou,W., Ye,L. and Ho,W.Z.
Journal J. Leukoc. Biol. 92 (2), 343-351 (2012)
Title The CXCR3(+)CD56Bright phenotype characterizes a distinct NK cell subset with anti-fibrotic potential that shows dys-regulated activity in hepatitis C .
Author Eisenhardt,M., Glassner,A., Kramer,B., Korner,C., Sibbing,B., Kokordelis,P., Nischalke,H.D., Sauerbruch,T., Spengler,U. and Nattermann,J.
Journal PLoS ONE 7 (7), E38846 (2012)
Title A discordance between the human muscle NCAM sequence and those seen in other NCAM cDNA clones .
Author Rossell,R.J., Malik,A., Helfrich,W., Kemshead,J.T. and Patel,K.
Journal Biochim. Biophys. Acta 1130 (1), 95-96 (1992)
Title Splicing of the VASE exon of neural cell adhesion molecule (NCAM) in human small-cell lung carcinoma (SCLC) .
Author van Duijnhoven,H.L., Helfrich,W., de Leij,L., Roebroek,A.J., van de Ven,W.J., Healey,K., Culverwell,A., Rossell,R.J., Kemshead,J.T. and Patel,K.
Journal Int. J. Cancer 50 (1), 118-123 (1992)
Title Molecular and functional analysis of human natural killer cell-associated neural cell adhesion molecule (N-CAM/CD56) .
Author Lanier,L.L., Chang,C., Azuma,M., Ruitenberg,J.J., Hemperly,J.J. and Phillips,J.H.
Journal J. Immunol. 146 (12), 4421-4426 (1991)
Title Precise in situ localization of NCAM, ETS1, and D11S29 on human meiotic chromosomes .
Author Bello,M.J., Salagnon,N., Rey,J.A., Guichaoua,M.R., Berge-Lefranc,J.L., Jordan,B.R. and Luciani,J.M.
Journal Cytogenet. Cell Genet. 52 (1-2), 7-10 (1989)
Title Human muscle neural cell adhesion molecule (N-CAM): identification of a muscle-specific sequence in the extracellular domain .
Author Dickson,G., Gower,H.J., Barton,C.H., Prentice,H.M., Elsom,V.L., Moore,S.E., Cox,R.D., Quinn,C., Putt,W. and Walsh,F.S.
Journal Cell 50 (7), 1119-1130 (1987)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.