• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens neural cell adhesion molecule 1 (NCAM1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu00262 Homo sapiens neural cell adhesion molecule 1 (NCAM1), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu00262C Homo sapiens neural cell adhesion molecule 1 (NCAM1), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000615.6, 336285433
Length 2547 bp
Structure linear
Update Date 15-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens neural cell adhesion molecule 1 (NCAM1), transcript variant 1, mRNA.
Product neural cell adhesion molecule 1 isoform 1 precursor
Comment

Summary: This gene encodes a cell adhesion protein which is a member of the immunoglobulin superfamily. The encoded protein is involved in cell-to-cell interactions as well as cell-matrix interactions during development and differentiation. The encoded protein has been shown to be involved in development of the nervous system, and for cells involved in the expansion of T cells and dendritic cells which play an important role in immune surveillance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2011].


Transcript Variant: This variant (1) lacks two alternate in-frame exons in the 3' coding region compared to variant 5. The resulting protein (isoform 1) is shorter compared to isoform 5.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000606.3
CDS 367..2913
Misc Feature(1)424..711
Misc Feature(2)427..702
Misc Feature(3)order(469..471,475..480)
Misc Feature(4)757..942
Misc Feature(5)769..936
Misc Feature(6)997..1287
Misc Feature(7)1030..1278
Misc Feature(8)1282..1572
Misc Feature(9)1333..1542
Misc Feature(10)1597..1833
Misc Feature(11)1630..1842
Misc Feature(12)1711..1713
Misc Feature(13)1798..1800
Misc Feature(14)1858..2151
Misc Feature(15)order(2068..2070,2113..2115)
Misc Feature(16)order(2116..2121,2125..2130)
Misc Feature(17)2212..2442
Misc Feature(18)order(2362..2364,2407..2409)
Misc Feature(19)order(2410..2415,2419..2424)
Misc Feature(20)2491..2553
Exon (1)1..418
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (2)419..493
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (3)494..712
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (4)713..856
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (5)857..994
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (6)995..1112
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (7)1113..1282
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (8)1283..1425
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (9)1426..1576
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (10)1577..1761
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (11)1762..1858
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (12)1859..2029
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (13)2030..2161
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (14)2162..2164
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (15)2165..2289
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (16)2290..2467
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (17)2468..2675
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (18)2676..2792
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Exon (19)2793..5962
Gene:NCAM1
Gene Synonym:CD56; MSK39; NCAM
Translation MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE KLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMF KNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGF PEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATI HLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKTLDGHMV VRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGN QVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCT AVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAV GEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVQG EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVM LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLSTGAIVGILIV IFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFSKDESKEPIVE VRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQ TKENESKA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
78+dbSNP:
78+c, gdbSNP:7938749
80+c, tdbSNP:139414593
81+c, tdbSNP:142518273
150..151+, cdbSNP:34274345
152+g, tdbSNP:372842188
203+g, tdbSNP:201971024
308..309+, gdbSNP:145493999
309..310+, gdbSNP:376464391
313+g, tdbSNP:199895300
314+g, tdbSNP:371422820
315+c, gdbSNP:374931900
331+c, tdbSNP:201206514
372+, gdbSNP:201772924
373+a, cdbSNP:112306738
385+c, tdbSNP:7105734
390+c, tdbSNP:6589347
402+a, tdbSNP:201161826
438+dbSNP:
438+c, tdbSNP:373994214
439+a, gdbSNP:377030084
489+c, tdbSNP:45561332
499+dbSNP:
499+a, gdbSNP:377478639
533+c, tdbSNP:370673346
630+c, tdbSNP:375507475
633+c, tdbSNP:200538356
637+a, gdbSNP:370887465
688+a, gdbSNP:188950571
693+c, tdbSNP:375471455
699+c, tdbSNP:181729481
732+dbSNP:
732+c, tdbSNP:191287596
755+a, gdbSNP:367901170
772+a, gdbSNP:200921858
831+c, tdbSNP:375478322
838+a, gdbSNP:369715213
842+a, tdbSNP:377357078
896+dbSNP:
896+a, gdbSNP:35576001
929+a, gdbSNP:376708434
1036+dbSNP:
1036+a, cdbSNP:199787286
1047+c, tdbSNP:17115154
1056+c, tdbSNP:371142479
1059+c, tdbSNP:17115156
1071+c, tdbSNP:376337341
1078+a, gdbSNP:371057906
1143+dbSNP:
1143+c, tdbSNP:372281288
1144+a, gdbSNP:17115160
1164+c, tdbSNP:369793545
1180+a, cdbSNP:372813723
1209+c, tdbSNP:139279798
1218+a, gdbSNP:17115163
1221+c, tdbSNP:144643875
1301+dbSNP:
1301+a, gdbSNP:373516826
1343+c, tdbSNP:376253720
1407+c, tdbSNP:370947557
1414+a, gdbSNP:201693511
1416+c, tdbSNP:34941275
1417+a, gdbSNP:185400485
1421+a, tdbSNP:376521254
1427+dbSNP:
1427+c, tdbSNP:372932320
1503+c, tdbSNP:35123203
1506+c, tdbSNP:190468342
1507+c, gdbSNP:55757519
1510+g, tdbSNP:56107970
1542+c, tdbSNP:375015033
1543+a, cdbSNP:369494821
1665+dbSNP:
1665+c, tdbSNP:370490360
1671+a, gdbSNP:375199115
1730+a, tdbSNP:200123115
1731+a, cdbSNP:368123885
1754+a, cdbSNP:186683121
1791+dbSNP:
1791+a, gdbSNP:372351899
1811+c, tdbSNP:375772892
1817+a, gdbSNP:367640227
1986+dbSNP:
1986+a, cdbSNP:386600109
complement(1986)-c, adbSNP:584427
2046+dbSNP:
2046+c, tdbSNP:375193862
2047+a, gdbSNP:370003415
complement(2055)-g, adbSNP:17115214
2056+a, gdbSNP:201325353
2064+a, gdbSNP:141690701
2070+c, tdbSNP:78645852
2078+c, tdbSNP:373450426
2082+c, tdbSNP:3741072
2085+c, tdbSNP:200726533
2086+a, gdbSNP:375525449
2096+c, tdbSNP:368426476
2097+a, gdbSNP:371294819
2100+a, gdbSNP:201910908
2130+c, tdbSNP:199567425
2132+c, tdbSNP:117485712
2133+a, gdbSNP:374753347
2140+a, gdbSNP:367913983
2176+dbSNP:
2176+a, gdbSNP:370134065
2177+c, tdbSNP:374347472
2193+a, gdbSNP:367932259
2250+c, tdbSNP:370796324
2288+c, tdbSNP:201635814
2322+dbSNP:
2322+c, tdbSNP:368661272
2325+a, gdbSNP:181774525
2340+c, tdbSNP:201880501
2373+g, tdbSNP:17115280
2427+c, tdbSNP:369197403
2430+g, tdbSNP:200953789
2461+a, gdbSNP:373282825
2482+dbSNP:
2482+a, cdbSNP:201796555
2483+c, gdbSNP:201646237
2499+c, tdbSNP:35515801
2509+a, gdbSNP:377610168
2523+c, tdbSNP:370972808
2533+a, gdbSNP:375678263
2556+c, tdbSNP:201927228
2601+c, tdbSNP:372851183
2603+c, tdbSNP:375931522
2604+a, gdbSNP:186731793
2613+c, gdbSNP:367641297
2631+c, tdbSNP:200353961
2634+a, gdbSNP:76495917
2635+g, tdbSNP:374937789
2668+g, tdbSNP:369240260
2697+dbSNP:
2697+c, tdbSNP:202190916
2711+a, gdbSNP:370372499
2726+a, gdbSNP:141580143
2748+a, gdbSNP:372717893
2765+a, gdbSNP:377484467
2766+c, tdbSNP:200459186
2775+a, gdbSNP:201752786
2784+a, gdbSNP:377666719
2802+dbSNP:
2802+c, tdbSNP:367916249
2810+a, cdbSNP:371691487
2811+a, cdbSNP:375010721
2837+a, gdbSNP:17174409
2846+c, tdbSNP:372122947
2864+c, tdbSNP:376721251
2877+c, tdbSNP:369914244
2878+a, gdbSNP:373049586
2886+c, gdbSNP:377426912
2899+g, tdbSNP:369107930
2903+a, gdbSNP:17854434
2928+c, tdbSNP:373641108
2977+, tdbSNP:60495668
2998..2999+, acdbSNP:375385430
2999+c, tdbSNP:192793968
3005+c, gdbSNP:1057924
complement(3040)-t, cdbSNP:142009888
3160+a, gdbSNP:112708952
3195+c, tdbSNP:140960623
3198..3199+, gdbSNP:35983476
3301+a, gdbSNP:371091897
3343+a, cdbSNP:373331866
3394+a, gdbSNP:144703582
3426+a, gdbSNP:371243900
3533+c, gdbSNP:17174410
3558+c, tdbSNP:185536769
3589+c, tdbSNP:635903
3589+c, tdbSNP:386602413
3681+a, gdbSNP:12275130
3708+a, tdbSNP:190740642
3717+a, gdbSNP:140002200
3767..3769+, acadbSNP:375971008
3818+a, tdbSNP:181669390
complement(3820)-t, cdbSNP:149972999
3822+c, tdbSNP:75175317
3838+c, tdbSNP:189146374
3929+c, gdbSNP:75854397
3938+c, tdbSNP:181105924
3979+a, gdbSNP:386434006
3979+c, tdbSNP:145196484
4014+g, tdbSNP:185747842
4038+g, tdbSNP:374126848
4167+c, tdbSNP:371874259
4196+c, tdbSNP:200617376
4355+a, gdbSNP:188258623
4361..4362+, gdbSNP:201011708
4361+, adbSNP:374394200
4361+a, gdbSNP:7927511
4363+c, gdbSNP:7927811
4427+c, tdbSNP:113237045
complement(4584)-g, adbSNP:148902519
4682+c, tdbSNP:115020540
4780+c, gdbSNP:187112956
4799+c, tdbSNP:143624850
4799+c, tdbSNP:386433729
4849+c, tdbSNP:367903607
4900+c, tdbSNP:146482354
4918+c, gdbSNP:11547504
4959+g, tdbSNP:117166580
4980+a, gdbSNP:111287313
4997+c, tdbSNP:144802378
5031+a, gdbSNP:111990038
5040+c, tdbSNP:138566380
5169+c, gdbSNP:74800806
5279+c, tdbSNP:12278611
5281+c, tdbSNP:12278614
5296+a, cdbSNP:12291713
5340+c, tdbSNP:192443926
5351+c, tdbSNP:12278666
5372..5373+, taaadbSNP:151080039
5375..5376+, taaadbSNP:56324717
5376+a, tdbSNP:12793334
5400..5401+, aaadbSNP:386374947
5403+c, tdbSNP:201678929
5436+c, tdbSNP:114476800
5473+g, tdbSNP:141207290
5487..5488+, ttcdbSNP:202178980
5541+c, tdbSNP:374930116
5564+g, tdbSNP:183948283
5592..5593+, aagtdbSNP:142769829
5596..5597+, aagtdbSNP:367903305
5687..5688+, tatdbSNP:372055188
5688+a, gdbSNP:117323688
5707+a, gdbSNP:185681645
5716+a, gdbSNP:369683258
5905+a, tdbSNP:9289
Gene SymbolNCAM1
Gene SynonymCD56; MSK39; NCAM
Chromosome11
Locus Map11q23.1
Title Dynein interacts with the neural cell adhesion molecule (NCAM180) to tether dynamic microtubules and maintain synaptic density in cortical neurons .
Author Perlson E, Hendricks AG, Lazarus JE, Ben-Yaakov K, Gradus T, Tokito
Journal J. Biol. Chem. 288 (39), 27812-27824 (2013)
Title CD56 expression is an independent prognostic factor for relapse in acute myeloid leukemia with t(8;21) .
Author Iriyama N, Hatta Y, Takeuchi J, Ogawa Y, Ohtake S, Sakura T, Mitani K, Ishida F, Takahashi M, Maeda T, Izumi T, Sakamaki H, Miyawaki S, Honda S, Miyazaki Y, Taki T, Taniwaki M and Naoe T.
Journal Leuk. Res. 37 (9), 1021-1026 (2013)
Title NCAM polysialylation during adherence transitions: live cell monitoring using an antibody-mimetic EGFP-endosialidase and the viability dye DRAQ7 .
Author Smith PJ, Furon E, Wiltshire M, Chappell S, Patterson LH, Shnyder SD, Falconer RA and Errington RJ.
Journal Cytometry A 83 (7), 659-671 (2013)
Title Polysialic acid is present in mammalian semen as a post-translational modification of the neural cell adhesion molecule NCAM and the polysialyltransferase ST8SiaII .
Author Simon P, Baumner S, Busch O, Rohrich R, Kaese M, Richterich P, Wehrend A, Muller K, Gerardy-Schahn R, Muhlenhoff M, Geyer H, Geyer R, Middendorff R and Galuska SP.
Journal J. Biol. Chem. 288 (26), 18825-18833 (2013)
Title Utility of the quantitative Ki-67 proliferation index and CD56 together in the cytologic diagnosis of small cell lung carcinoma and other lung neuroendocrine tumors .
Author Zheng G, Ettinger DS and Maleki Z.
Journal Acta Cytol. 57 (3), 281-290 (2013)
Title A discordance between the human muscle NCAM sequence and those seen in other NCAM cDNA clones .
Author Rossell RJ, Malik A, Helfrich W, Kemshead JT and Patel K.
Journal Biochim. Biophys. Acta 1130 (1), 95-96 (1992)
Title Splicing of the VASE exon of neural cell adhesion molecule (NCAM) in human small-cell lung carcinoma (SCLC) .
Author van Duijnhoven HL, Helfrich W, de Leij L, Roebroek AJ, van de Ven WJ, Healey K, Culverwell A, Rossell RJ, Kemshead JT and Patel K.
Journal Int. J. Cancer 50 (1), 118-123 (1992)
Title Molecular and functional analysis of human natural killer cell-associated neural cell adhesion molecule (N-CAM/CD56) .
Author Lanier LL, Chang C, Azuma M, Ruitenberg JJ, Hemperly JJ and Phillips JH.
Journal J. Immunol. 146 (12), 4421-4426 (1991)
Title Precise in situ localization of NCAM, ETS1, and D11S29 on human meiotic chromosomes .
Author Bello MJ, Salagnon N, Rey JA, Guichaoua MR, Berge-Lefranc JL, Jordan BR and Luciani JM.
Journal Cytogenet. Cell Genet. 52 (1-2), 7-10 (1989)
Title Human muscle neural cell adhesion molecule (N-CAM): identification of a muscle-specific sequence in the extracellular domain .
Author Dickson,G., Gower,H.J., Barton,C.H., Prentice,H.M., Elsom,V.L., Moore,S.E., Cox,R.D., Quinn,C., Putt,W. and Walsh,F.S.
Journal Cell 50 (7), 1119-1130 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.