• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_000620 Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 1, mRNA. ORF Sequence $1506.75
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000620.4, 323635432
Length 12189 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 1, mRNA.
Product nitric oxide synthase, brain isoform 1
Comment

Summary: The protein encoded by this gene belongs to the family of nitric oxide synthases, which synthesize nitric oxide from L-arginine. Nitric oxide is a reactive free radical, which acts as a biologic mediator in several processes, including neurotransmission, and antimicrobial and antitumoral activities. In the brain and peripheral nervous system, nitric oxide displays many properties of a neurotransmitter, and has been implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. This protein is ubiquitously expressed, with high level of expression in skeletal muscle. Multiple transcript variants that differ in the 5' UTR have been described for this gene but the full-length nature of these transcripts is not known. Additionally, alternatively spliced transcript variants encoding different isoforms (some testis-specific) have been found for this gene.[provided by RefSeq, Feb 2011].


Transcript Variant: This variant (1) represents the predominant transcript, and encodes isoform 1 (also known as nNOS).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000611.1
CDS 712..5016
Misc Feature(1)622..624
Misc Feature(2)712..1326
Misc Feature(3)712..1326
Misc Feature(4)754..1005
Misc Feature(5)order(790..801,802..804,949..954,961..966)
Misc Feature(6)1198..1446
Misc Feature(7)1624..2859
Misc Feature(8)order(1642..1647,1678..1680,1684..1686,1696..1698,
Misc Feature(9)order(1969..1971,2158..2160,2410..2412,2476..2481,
Misc Feature(10)2899..2961
Misc Feature(11)2947..2949
Misc Feature(12)2965..4911
Misc Feature(13)2974..3033
Misc Feature(14)2995..3516
Misc Feature(15)3265..3267
Misc Feature(16)3265..3267
Misc Feature(17)3265..3267
Misc Feature(18)3265..3267
Misc Feature(19)3265..3267
Misc Feature(20)3712..4923
Misc Feature(21)order(3793..3795,3961..3966,4270..4272,4279..4281,
Misc Feature(22)order(3820..3822,4243..4254,4297..4299,4303..4305,
Misc Feature(23)order(4243..4245,4249..4254)
Misc Feature(24)order(4252..4254,4771..4773,4903..4905,4909..4911)
Misc Feature(25)order(4303..4314,4471..4473,4477..4479,4573..4578,
Misc Feature(26)order(4351..4353,4360..4362,4369..4371)
Misc Feature(27)order(4462..4464,4474..4485,4489..4491)
Misc Feature(28)4960..4962
Exon (1)1..291
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (2)292..1436
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (3)1437..1563
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (4)1564..1692
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (5)1693..1838
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (6)1839..2001
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (7)2002..2093
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (8)2094..2235
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (9)2236..2375
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (10)2376..2550
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (11)2551..2652
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (12)2653..2847
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (13)2848..2933
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (14)2934..3078
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (15)3079..3183
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (16)3184..3242
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (17)3243..3359
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (18)3360..3534
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (19)3535..3673
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (20)3674..3752
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (21)3753..3946
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (22)3947..4116
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (23)4117..4327
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (24)4328..4415
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (25)4416..4537
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (26)4538..4686
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (27)4687..4881
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (28)4882..5000
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (29)5001..12183
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Translation MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA GDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI RVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP RPPGQDPAKKATRVSLQGRGENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQV DRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPS KCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVRTKGQLF PLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRC VGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVW NSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQ IPPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGV RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHV WKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCE IFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQ EERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF GHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANN SLISNDRSWKRNKFRLTFVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFV RLHTNGSQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGV ISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEY EEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIV SYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP FRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSRE PDKPKKYVQDILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAE DAGVFISRMRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(59)-dbSNP:
complement(59)-t, cdbSNP:9658256
complement(96..97)-, gdbSNP:77719951
complement(97)-, cdbSNP:9658257
complement(252)-g, adbSNP:9658258
complement(315)-dbSNP:
complement(315)-t, cdbSNP:9658274
complement(324)-g, adbSNP:41444054
complement(370)-g, adbSNP:181911224
complement(403)-g, cdbSNP:113139853
complement(501)-t, gdbSNP:41502449
complement(521)-t, cdbSNP:148285355
complement(524)-t, cdbSNP:117818452
complement(548)-g, adbSNP:3741481
complement(618)-g, adbSNP:190212141
complement(685)-c, adbSNP:55862170
complement(692)-g, adbSNP:149094648
complement(705)-t, cdbSNP:187316016
complement(729)-g, adbSNP:199921187
complement(766)-t, cdbSNP:78402290
complement(779)-t, cdbSNP:56308341
complement(785)-g, adbSNP:145235328
complement(790)-t, cdbSNP:201449570
complement(828)-t, cdbSNP:147067686
complement(853)-c, adbSNP:80348085
complement(854)-t, cdbSNP:201294492
complement(861)-g, cdbSNP:41459647
complement(909)-g, adbSNP:9658275
complement(920)-g, adbSNP:74738204
complement(948)-g, adbSNP:201853230
complement(984)-t, cdbSNP:9658276
complement(987)-t, cdbSNP:76980269
complement(1025)-t, cdbSNP:76839820
complement(1026)-g, adbSNP:9658277
complement(1046)-t, cdbSNP:75386866
complement(1131)-g, adbSNP:9658278
complement(1169)-g, adbSNP:41514244
complement(1175)-g, adbSNP:199870977
complement(1240)-t, cdbSNP:41340250
complement(1249)-g, adbSNP:41474747
complement(1270)-g, adbSNP:200282713
complement(1358)-g, adbSNP:55922940
complement(1393)-t, cdbSNP:9658279
complement(1432)-g, adbSNP:76090928
complement(1474)-dbSNP:
complement(1474)-t, cdbSNP:199588951
complement(1476)-t, cdbSNP:9658302
complement(1485)-g, adbSNP:183697436
complement(1495)-c, adbSNP:200602438
complement(1515)-t, cdbSNP:201396150
complement(1577)-dbSNP:
complement(1577)-t, cdbSNP:147820513
complement(1587)-g, adbSNP:41347148
complement(1589)-g, adbSNP:200423967
complement(1654)-t, cdbSNP:56219642
complement(1760)-dbSNP:
complement(1760)-g, adbSNP:4519169
complement(1768)-t, cdbSNP:202090735
complement(1776)-t, cdbSNP:145850106
complement(1793)-g, adbSNP:183839261
complement(1798)-t, cdbSNP:149855373
complement(1801)-t, cdbSNP:201351707
complement(1818)-g, adbSNP:71653610
complement(1844)-dbSNP:
complement(1844)-g, cdbSNP:191073515
complement(1890)-t, cdbSNP:76151454
complement(1892)-c, adbSNP:9658356
complement(1950)-t, cdbSNP:77967226
complement(2024)-dbSNP:
complement(2024)-t, gdbSNP:200231850
complement(2136)-dbSNP:
complement(2136)-g, adbSNP:201316068
complement(2172)-t, cdbSNP:9658362
complement(2193)-g, adbSNP:181652902
complement(2263..2264)-dbSNP:
complement(2263..2264)-, gdbSNP:144468435
complement(2307)-g, adbSNP:199772308
complement(2424)-dbSNP:
complement(2424)-g, adbSNP:200268741
complement(2494)-t, cdbSNP:41356652
complement(2530)-t, cdbSNP:71653608
complement(2566)-dbSNP:
complement(2566)-t, adbSNP:79487279
complement(2631)-g, adbSNP:202177894
complement(2821)-dbSNP:
complement(2821)-c, adbSNP:79673175
complement(2826)-g, adbSNP:188225824
complement(2864)-dbSNP:
complement(2864)-g, adbSNP:200091597
complement(2884)-g, adbSNP:9658403
complement(2885)-t, cdbSNP:199519839
complement(2913)-g, adbSNP:2293054
complement(2961)-dbSNP:
complement(2961)-c, adbSNP:201091025
complement(3023)-g, adbSNP:150227193
complement(3024)-g, adbSNP:79567967
complement(3194)-dbSNP:
complement(3194)-t, cdbSNP:200144876
complement(3221)-g, adbSNP:77828469
complement(3302)-dbSNP:
complement(3302)-g, adbSNP:9658445
complement(3304)-t, cdbSNP:200664091
complement(3312)-t, cdbSNP:9658446
complement(3317)-g, adbSNP:142354668
complement(3378)-dbSNP:
complement(3378)-g, adbSNP:148369257
complement(3406)-t, cdbSNP:201533403
complement(3417)-t, cdbSNP:1047735
complement(3429)-g, adbSNP:201696256
complement(3432)-g, adbSNP:41410247
complement(3465)-g, adbSNP:74595776
complement(3471)-g, adbSNP:2291906
complement(3531)-t, cdbSNP:76112078
complement(3536)-dbSNP:
complement(3536)-t, gdbSNP:199681806
complement(3777)-dbSNP:
complement(3777)-g, cdbSNP:13377860
complement(3870)-g, adbSNP:41413747
complement(3881)-t, cdbSNP:201526014
complement(3887)-g, adbSNP:56266548
complement(3888)-t, cdbSNP:192297868
complement(3902)-g, adbSNP:9658482
complement(3945)-g, adbSNP:78399557
complement(3969)-dbSNP:
complement(3969)-g, adbSNP:3741475
complement(4005)-t, cdbSNP:74585703
complement(4017)-g, adbSNP:116498586
complement(4031)-g, adbSNP:201943901
complement(4032)-g, adbSNP:78855995
complement(4041)-g, adbSNP:77927749
complement(4065)-g, cdbSNP:200189905
complement(4069)-g, adbSNP:200364359
complement(4097)-g, adbSNP:78422671
complement(4121)-dbSNP:
complement(4121)-, adbSNP:57012772
complement(4164)-t, cdbSNP:9658500
complement(4188)-t, cdbSNP:202207077
complement(4228)-t, cdbSNP:71653609
complement(4231)-t, cdbSNP:80312270
complement(4233)-t, cdbSNP:34375182
complement(4243)-t, cdbSNP:77074921
complement(4251)-g, adbSNP:200168308
complement(4299)-t, cdbSNP:9658501
complement(4395)-dbSNP:
complement(4395)-g, cdbSNP:201760168
complement(4577)-dbSNP:
complement(4577)-t, cdbSNP:199524143
complement(4729)-dbSNP:
complement(4729)-g, adbSNP:76104785
complement(4758)-c, adbSNP:9658533
complement(4768)-g, adbSNP:74427117
complement(4770)-t, gdbSNP:2293044
complement(4845)-t, cdbSNP:190492371
complement(4857)-g, adbSNP:146276987
complement(4959)-dbSNP:
complement(4959)-g, adbSNP:9658545
complement(4975)-g, cdbSNP:201476356
complement(4995)-g, cdbSNP:191788603
complement(5024)-dbSNP:
complement(5024)-t, cdbSNP:9658557
complement(5154)-g, adbSNP:188122745
complement(5156)-g, adbSNP:144042938
complement(5236)-t, gdbSNP:183343930
complement(5292)-t, cdbSNP:2682826
complement(5324)-t, cdbSNP:3741473
complement(5331)-g, adbSNP:9658558
complement(5383)-t, cdbSNP:9658559
complement(5457..5460)-, acagdbSNP:60094430
complement(5457..5458)-, ag, cadbSNP:60470377
complement(5457)-g, cdbSNP:11068415
complement(5483)-c, adbSNP:192623102
complement(5489..5490)-, acdbSNP:145880725
complement(5490..5491)-, cadbSNP:66475340
complement(5493..5494)-, cadbSNP:144158800
complement(5510)-g, adbSNP:139248593
complement(5518)-t, adbSNP:9658560
complement(5610)-g, adbSNP:116103924
complement(5680)-t, cdbSNP:2133681
complement(5780)-g, adbSNP:187527080
complement(5881)-g, adbSNP:41511544
complement(5926)-t, gdbSNP:9658561
complement(5942)-, cdbSNP:139368187
complement(6009)-g, adbSNP:148683456
complement(6073)-t, adbSNP:9658562
complement(6127)-, adbSNP:200320647
complement(6212)-t, gdbSNP:144160475
complement(6286)-t, cdbSNP:55848937
complement(6387)-g, adbSNP:9658563
complement(6424)-t, cdbSNP:191201038
complement(6469..6470)-, gdbSNP:200187904
complement(6472)-, cdbSNP:9658564
complement(6479)-t, adbSNP:3937939
complement(6563)-g, adbSNP:149499912
complement(6590)-t, adbSNP:187888090
complement(6651)-t, adbSNP:79050955
complement(6653)-t, gdbSNP:76688506
complement(6677)-g, adbSNP:41472247
complement(6682..6683)-, cdbSNP:35032440
complement(6703)-t, cdbSNP:7132722
complement(6763)-g, adbSNP:9658565
complement(6896)-c, adbSNP:9658566
complement(6903)-g, adbSNP:9658567
complement(6938)-g, cdbSNP:139149689
complement(6961)-t, adbSNP:9658568
complement(7078)-g, adbSNP:147417836
complement(7088)-t, cdbSNP:143103197
complement(7124)-g, adbSNP:9658569
complement(7257)-t, gdbSNP:9658570
complement(7326)-t, cdbSNP:182678396
complement(7348)-t, gdbSNP:9658571
complement(7349..7351)-, aatdbSNP:201438460
complement(7356..7358)-, tttdbSNP:9658572
complement(7391)-t, gdbSNP:9658573
complement(7406)-g, adbSNP:9658574
complement(7574)-g, cdbSNP:190966281
complement(7671)-t, cdbSNP:146322728
complement(7760)-t, cdbSNP:185817085
complement(7780)-g, cdbSNP:181477006
complement(7835)-g, adbSNP:9658575
complement(7849)-t, cdbSNP:185893125
complement(7853)-c, adbSNP:141850448
complement(7896..7897)-, gdbSNP:34041352
complement(7930)-t, cdbSNP:113116092
complement(8133)-g, adbSNP:181503962
complement(8249)-t, adbSNP:11614833
complement(8249)-, adbSNP:63146860
complement(8250..8251)-, adbSNP:201129386
complement(8250)-t, adbSNP:11615277
complement(8260..8261)-, aaadbSNP:71940674
complement(8261..8262)-, aaadbSNP:113562322
complement(8359)-g, adbSNP:189500255
complement(8400)-t, cdbSNP:184655263
complement(8562..8563)-, gdbSNP:34230698
complement(8570)-t, gdbSNP:148157181
complement(8573)-t, cdbSNP:143822731
complement(8662)-g, adbSNP:9658576
complement(8668)-t, cdbSNP:181973345
complement(8683)-g, adbSNP:148968673
complement(8769)-t, cdbSNP:79836876
complement(8794)-g, adbSNP:189553587
complement(8835)-g, cdbSNP:184123968
complement(8926)-c, adbSNP:117665273
complement(9006)-g, adbSNP:11616132
complement(9074)-c, adbSNP:146845730
complement(9119)-t, cdbSNP:111412016
complement(9225)-g, adbSNP:140280164
complement(9358..9359)-, tdbSNP:63278660
complement(9363..9364)-, tdbSNP:112986513
complement(9384..9385)-, ttttadbSNP:200856589
complement(9398)-g, cdbSNP:113781886
complement(9412)-g, cdbSNP:146701658
complement(9451)-t, cdbSNP:192931503
complement(9463)-t, cdbSNP:60695198
complement(9478)-t, cdbSNP:187127850
complement(9638)-t, gdbSNP:78784523
complement(9746)-t, cdbSNP:184716708
complement(9748)-t, gdbSNP:36016891
complement(9798..9799)-, gdbSNP:34018958
complement(9913)-t, gdbSNP:192063777
complement(10067)-c, adbSNP:149657692
complement(10109)-g, adbSNP:11068413
complement(10119)-g, cdbSNP:58982059
complement(10155)-g, adbSNP:111962507
complement(10183..10185)-, tttdbSNP:61212156
complement(10184..10185)-, ttdbSNP:146442744
complement(10185)-, ttdbSNP:63711862
complement(10240)-t, gdbSNP:142690571
complement(10273)-t, cdbSNP:184109702
complement(10429)-g, adbSNP:1105026
complement(10727)-g, adbSNP:10774907
complement(10912)-g, adbSNP:117321346
complement(10916)-g, cdbSNP:117860105
complement(10977)-t, cdbSNP:139810727
complement(11025)-t, cdbSNP:10774906
complement(11028)-t, cdbSNP:12425729
complement(11031)-g, adbSNP:61152712
complement(11094)-g, adbSNP:56709211
complement(11179)-t, cdbSNP:147401367
complement(11208)-g, cdbSNP:74567483
complement(11257)-c, adbSNP:73393697
complement(11474)-g, adbSNP:3196412
complement(11518)-t, cdbSNP:140783357
complement(11534)-t, cdbSNP:7308150
complement(11575)-t, gdbSNP:191867506
complement(11595..11596)-, t, ttttdbSNP:10644899
complement(11902..11903)-, tgtgtgtgtgtgtgtgdbSNP:58714999
complement(11917..11918)-, tgtgtgtgtgtgtgtgdbSNP:72189596
complement(11932..11933)-, gt, gtgtgtgtgtgtgtgtdbSNP:66886445
complement(11933..11934)-, gtdbSNP:71444610
Gene SymbolNOS1
Gene SynonymbNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Chromosome12
Locus Map12q24.2-q24.31
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000620 Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 1, mRNA. Full Length Quote
ORF Sequence $1506.75
NM_001204213 Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 3, mRNA. Full Length Quote
ORF Sequence $1153.95
NM_001204214 Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 4, mRNA. Full Length Quote
ORF Sequence $1153.95
NM_001204218 Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 2, mRNA. Full Length Quote
ORF Sequence $1542.45
Title Charge-pairing interactions control the conformational setpoint and motions of the FMN domain in neuronal nitric oxide synthase .
Author Haque,M.M., Bayachou,M., Fadlalla,M.A., Durra,D. and Stuehr,D.J.
Journal Biochem. J. 450 (3), 607-617 (2013)
Title Calmodulin activates neuronal nitric oxide synthase by enabling transitions between conformational states .
Author Salerno,J.C., Ray,K., Poulos,T., Li,H. and Ghosh,D.K.
Journal FEBS Lett. 587 (1), 44-47 (2013)
Title Association of a functional variant of the nitric oxide synthase 1 gene with personality, anxiety, and depressiveness .
Author Kurrikoff,T., Lesch,K.P., Kiive,E., Konstabel,K., Herterich,S., Veidebaum,T., Reif,A. and Harro,J.
Journal Dev. Psychopathol. 24 (4), 1225-1235 (2012)
Title Transcription of different exons 1 of the human neuronal nitric oxide synthase gene is dynamically regulated in a cell- and stimulus-specific manner .
Author Boissel,J.P., Zelenka,M., Godtel-Armbrust,U., Feuerstein,T.J. and Forstermann,U.
Journal Biol. Chem. 384 (3), 351-362 (2003)
Title Isolation and characterization of a novel, human neuronal nitric oxide synthase cDNA .
Author Larsson,B. and Phillips,S.C.
Journal Biochem. Biophys. Res. Commun. 251 (3), 898-902 (1998)
Title A novel, testis-specific mRNA transcript encoding an NH2-terminal truncated nitric-oxide synthase .
Author Wang,Y., Goligorsky,M.S., Lin,M., Wilcox,J.N. and Marsden,P.A.
Journal J. Biol. Chem. 272 (17), 11392-11401 (1997)
Title Cysteine 99 of endothelial nitric oxide synthase (NOS-III) is critical for tetrahydrobiopterin-dependent NOS-III stability and activity .
Author Chen,P.F., Tsai,A.L. and Wu,K.K.
Journal Biochem. Biophys. Res. Commun. 215 (3), 1119-1129 (1995)
Title Localization of brain nitric oxide synthase (NOS) to human chromosome 12 .
Author Kishimoto,J., Spurr,N., Liao,M., Lizhi,L., Emson,P. and Xu,W.
Journal Genomics 14 (3), 802-804 (1992)
Title Cloned and expressed macrophage nitric oxide synthase contrasts with the brain enzyme .
Author Lowenstein,C.J., Glatt,C.S., Bredt,D.S. and Snyder,S.H.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (15), 6711-6715 (1992)
Title Nitric oxide synthase regulatory sites. Phosphorylation by cyclic AMP-dependent protein kinase, protein kinase C, and calcium/calmodulin protein kinase; identification of flavin and calmodulin binding sites .
Author Bredt,D.S., Ferris,C.D. and Snyder,S.H.
Journal J. Biol. Chem. 267 (16), 10976-10981 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878