• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000620 Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_000620.4, 323635432
Length 12189 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 1, mRNA.
Product nitric oxide synthase, brain isoform 1
Comment

Summary: The protein encoded by this gene belongs to the family of nitric oxide synthases, which synthesize nitric oxide from L-arginine. Nitric oxide is a reactive free radical, which acts as a biologic mediator in several processes, including neurotransmission, and antimicrobial and antitumoral activities. In the brain and peripheral nervous system, nitric oxide displays many properties of a neurotransmitter, and has been implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. This protein is ubiquitously expressed, with high level of expression in skeletal muscle. Multiple transcript variants that differ in the 5' UTR have been described for this gene but the full-length nature of these transcripts is not known. Additionally, alternatively spliced transcript variants encoding different isoforms (some testis-specific) have been found for this gene.[provided by RefSeq, Feb 2011].


Transcript Variant: This variant (1) represents the predominant transcript, and encodes isoform 1 (also known as nNOS).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000611.1
CDS 712..5016
Misc Feature(1)622..624
Misc Feature(2)712..1326
Misc Feature(3)712..1326
Misc Feature(4)754..1005
Misc Feature(5)order(790..801,802..804,949..954,961..966)
Misc Feature(6)<1066..>1407
Misc Feature(7)1198..1446
Misc Feature(8)1624..2859
Misc Feature(9)order(1642..1647,1678..1680,1684..1686,1696..1698,
Misc Feature(10)order(1969..1971,2158..2160,2410..2412,2476..2481,
Misc Feature(11)2899..2961
Misc Feature(12)2947..2949
Misc Feature(13)2974..3033
Misc Feature(14)2986..4908
Misc Feature(15)2995..3516
Misc Feature(16)3265..3267
Misc Feature(17)3265..3267
Misc Feature(18)3265..3267
Misc Feature(19)3265..3267
Misc Feature(20)3265..3267
Misc Feature(21)3712..4923
Misc Feature(22)order(3793..3795,3961..3966,4270..4272,4279..4281,
Misc Feature(23)order(3820..3822,4243..4254,4297..4299,4303..4305,
Misc Feature(24)order(4243..4245,4249..4254)
Misc Feature(25)order(4252..4254,4771..4773,4903..4905,4909..4911)
Misc Feature(26)order(4303..4314,4471..4473,4477..4479,4573..4578,
Misc Feature(27)order(4351..4353,4360..4362,4369..4371)
Misc Feature(28)order(4462..4464,4474..4485,4489..4491)
Misc Feature(29)4960..4962
Exon (1)1..291
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (2)292..1436
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (3)1437..1563
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (4)1564..1692
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (5)1693..1838
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (6)1839..2001
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (7)2002..2093
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (8)2094..2235
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (9)2236..2375
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (10)2376..2550
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (11)2551..2652
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (12)2653..2847
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (13)2848..2933
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (14)2934..3078
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (15)3079..3183
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (16)3184..3242
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (17)3243..3359
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (18)3360..3534
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (19)3535..3673
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (20)3674..3752
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (21)3753..3946
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (22)3947..4116
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (23)4117..4327
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (24)4328..4415
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (25)4416..4537
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (26)4538..4686
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (27)4687..4881
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (28)4882..5000
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Exon (29)5001..12183
Gene:NOS1
Gene Synonym:bNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Translation MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA GDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI RVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP RPPGQDPAKKATRVSLQGRGENNELLKEIEPVLSLLTSGSRGVKGGAPAKAEMKDMGIQV DRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPTSGKQSPTKNGSPS KCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRPEDVRTKGQLF PLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRC VGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVW NSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQ IPPELVLEVPIRHPKFEWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGV RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHV WKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCE IFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQ EERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF GHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANN SLISNDRSWKRNKFRLTFVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFV RLHTNGSQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGV ISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEY EEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIV SYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP FRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSRE PDKPKKYVQDILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAE DAGVFISRMRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(59)-dbSNP:
complement(59)-t, cdbSNP:9658256
complement(59)-g, adbSNP:386624108
complement(96..97)-, gdbSNP:77719951
97+, cdbSNP:9658257
complement(252)-g, adbSNP:9658258
complement(315)-dbSNP:
complement(315)-t, cdbSNP:9658274
complement(324)-g, adbSNP:41444054
complement(370)-g, adbSNP:181911224
complement(403)-g, cdbSNP:113139853
complement(468)-g, adbSNP:373128649
complement(501)-t, gdbSNP:41502449
complement(521)-t, cdbSNP:148285355
complement(524)-t, cdbSNP:117818452
complement(548)-g, adbSNP:3741481
complement(618)-g, adbSNP:190212141
complement(685)-c, adbSNP:55862170
complement(692)-g, adbSNP:149094648
complement(697)-g, adbSNP:373842992
complement(705)-t, cdbSNP:187316016
complement(726)-t, cdbSNP:370088613
complement(729)-g, adbSNP:199921187
complement(733)-t, cdbSNP:375081888
complement(738)-t, cdbSNP:372963498
complement(766)-t, cdbSNP:78402290
complement(767)-t, cdbSNP:374891208
complement(779)-t, cdbSNP:56308341
complement(785)-g, adbSNP:145235328
complement(790)-t, cdbSNP:201449570
complement(825)-t, cdbSNP:371971228
complement(828)-t, cdbSNP:147067686
complement(831)-g, adbSNP:376394505
853+a, cdbSNP:80348085
complement(854)-t, cdbSNP:201294492
861+c, gdbSNP:41459647
complement(864)-g, adbSNP:368807999
complement(873)-g, cdbSNP:373710373
909+a, c, gdbSNP:9658275
920+a, gdbSNP:74738204
complement(946)-t, cdbSNP:368050156
complement(948)-g, adbSNP:201853230
complement(984)-t, cdbSNP:9658276
complement(984)-g, adbSNP:386447692
987+c, tdbSNP:76980269
complement(1005)-g, cdbSNP:370576212
complement(1009)-g, adbSNP:376848682
1025+c, tdbSNP:76839820
1026+a, gdbSNP:9658277
1046+c, tdbSNP:75386866
complement(1047)-t, cdbSNP:371133098
complement(1131)-g, adbSNP:9658278
complement(1143)-t, cdbSNP:372667819
complement(1163)-t, cdbSNP:368845605
complement(1169)-g, adbSNP:41514244
complement(1170)-t, cdbSNP:372921010
complement(1175)-g, adbSNP:199870977
complement(1176)-g, adbSNP:369224010
complement(1200)-g, adbSNP:375672027
complement(1231)-g, cdbSNP:372299035
complement(1239)-g, adbSNP:368656923
complement(1240)-t, cdbSNP:41340250
complement(1249)-g, adbSNP:41474747
complement(1267)-t, cdbSNP:267603328
complement(1270)-g, adbSNP:200282713
complement(1274)-g, adbSNP:374847966
complement(1358)-g, adbSNP:55922940
complement(1370)-t, cdbSNP:367886122
complement(1391)-t, gdbSNP:374287206
1393+c, tdbSNP:9658279
complement(1393)-g, adbSNP:386624115
complement(1432)-g, adbSNP:76090928
complement(1465)-dbSNP:
complement(1465)-g, adbSNP:375810209
complement(1468)-g, adbSNP:372496012
complement(1473)-g, adbSNP:369258103
complement(1474)-t, cdbSNP:199588951
complement(1476)-t, cdbSNP:9658302
complement(1485)-g, adbSNP:183697436
complement(1495)-c, adbSNP:200602438
complement(1497)-g, adbSNP:369657739
complement(1499)-t, cdbSNP:375497770
complement(1514)-t, adbSNP:372978384
complement(1515)-t, cdbSNP:201396150
complement(1530)-g, adbSNP:369890513
complement(1544)-g, cdbSNP:376609433
complement(1577)-dbSNP:
complement(1577)-t, cdbSNP:147820513
complement(1587)-g, adbSNP:41347148
complement(1589)-g, adbSNP:200423967
complement(1654)-t, cdbSNP:56219642
complement(1686)-t, gdbSNP:368132541
complement(1698)-dbSNP:
complement(1698)-t, cdbSNP:368611180
complement(1731)-t, gdbSNP:374276851
complement(1760)-g, adbSNP:4519169
complement(1768)-t, cdbSNP:202090735
complement(1776)-t, cdbSNP:145850106
complement(1785)-t, cdbSNP:376348856
complement(1793)-g, adbSNP:183839261
complement(1798)-t, cdbSNP:149855373
complement(1801)-t, cdbSNP:201351707
1818+a, gdbSNP:71653610
complement(1844)-dbSNP:
complement(1844)-g, cdbSNP:191073515
1890+c, tdbSNP:76151454
complement(1892)-c, adbSNP:9658356
complement(1892)-c, adbSNP:386624116
1950+c, tdbSNP:77967226
complement(1980)-t, cdbSNP:267603327
complement(2010)-dbSNP:
complement(2010)-g, adbSNP:372261923
complement(2024)-t, gdbSNP:200231850
complement(2028)-t, cdbSNP:374310920
complement(2049)-g, adbSNP:371784708
complement(2128)-dbSNP:
complement(2128)-t, cdbSNP:371044828
complement(2136)-g, adbSNP:201316068
complement(2166)-g, adbSNP:373672725
complement(2172)-t, cdbSNP:9658362
complement(2193)-g, adbSNP:181652902
complement(2203)-t, gdbSNP:374214088
complement(2219)-t, cdbSNP:370872273
complement(2261..2262)-dbSNP:
complement(2261..2262)-, gdbSNP:144468435
complement(2283)-t, gdbSNP:369893598
complement(2307)-g, adbSNP:199772308
complement(2422)-dbSNP:
complement(2422)-t, cdbSNP:368153115
complement(2424)-g, adbSNP:200268741
complement(2494)-t, cdbSNP:41356652
complement(2514)-g, adbSNP:371959195
2530+c, tdbSNP:71653608
complement(2541)-g, adbSNP:372404284
complement(2554)-dbSNP:
complement(2554)-c, adbSNP:368542192
complement(2558)-g, cdbSNP:374363198
complement(2566)-t, adbSNP:79487279
complement(2588)-g, adbSNP:368042252
complement(2631)-g, adbSNP:202177894
complement(2640)-g, adbSNP:375373992
complement(2670)-dbSNP:
complement(2670)-t, adbSNP:373113704
complement(2728)-t, adbSNP:371526684
complement(2745)-c, adbSNP:376857384
complement(2748)-g, adbSNP:373128855
complement(2821)-c, adbSNP:79673175
complement(2826)-g, adbSNP:188225824
complement(2864)-dbSNP:
complement(2864)-g, adbSNP:200091597
complement(2884)-g, adbSNP:9658403
complement(2884)-g, adbSNP:386624117
complement(2885)-t, cdbSNP:199519839
complement(2886)-g, adbSNP:371866813
complement(2913)-g, adbSNP:2293054
complement(2913)-g, adbSNP:386563994
complement(2949)-dbSNP:
complement(2949)-t, cdbSNP:374845566
complement(2961)-c, adbSNP:201091025
complement(2982)-t, cdbSNP:370791066
complement(3009)-t, cdbSNP:368292097
complement(3018)-t, gdbSNP:367866506
complement(3023)-g, adbSNP:150227193
3024+a, gdbSNP:79567967
complement(3044)-c, adbSNP:377522994
complement(3194)-dbSNP:
complement(3194)-t, cdbSNP:200144876
3221+a, gdbSNP:77828469
complement(3249)-dbSNP:
complement(3249)-g, adbSNP:369442400
complement(3276)-g, adbSNP:376834281
complement(3302)-g, adbSNP:9658445
complement(3304)-t, cdbSNP:200664091
complement(3312)-t, cdbSNP:9658446
complement(3317)-g, adbSNP:142354668
complement(3378)-dbSNP:
complement(3378)-g, adbSNP:148369257
complement(3382)-c, adbSNP:369089315
complement(3405)-g, adbSNP:375782081
complement(3406)-t, cdbSNP:201533403
complement(3411)-g, adbSNP:369052450
3417+c, tdbSNP:1047735
complement(3429)-g, adbSNP:201696256
complement(3432)-g, adbSNP:41410247
3465+a, gdbSNP:74595776
3471+a, gdbSNP:2291906
complement(3498)-t, cdbSNP:371848878
3531+c, tdbSNP:76112078
complement(3536)-dbSNP:
complement(3536)-t, gdbSNP:199681806
complement(3590)-t, cdbSNP:367889506
complement(3670)-t, gdbSNP:374309059
complement(3713)-dbSNP:
complement(3713)-t, cdbSNP:370868180
complement(3759)-dbSNP:
complement(3759)-t, gdbSNP:370076270
complement(3768)-g, adbSNP:376014944
complement(3772)-g, adbSNP:375069851
complement(3777)-g, cdbSNP:13377860
complement(3840)-g, adbSNP:369360401
complement(3855)-g, adbSNP:374883833
complement(3870)-g, adbSNP:41413747
complement(3881)-t, cdbSNP:201526014
complement(3887)-g, adbSNP:56266548
complement(3888)-t, cdbSNP:192297868
3902+a, gdbSNP:9658482
complement(3902)-t, cdbSNP:386624121
complement(3904)-t, cdbSNP:371188803
complement(3907)-t, cdbSNP:375160978
complement(3932)-t, cdbSNP:372427472
complement(3945)-g, adbSNP:78399557
complement(3969)-dbSNP:
complement(3969)-t, cdbSNP:386585222
complement(3969)-g, adbSNP:3741475
complement(3983)-g, adbSNP:375371439
complement(4004)-g, adbSNP:370568363
4005+c, tdbSNP:74585703
complement(4017)-g, adbSNP:116498586
complement(4031)-g, adbSNP:201943901
4032+a, gdbSNP:78855995
complement(4041)-g, adbSNP:77927749
complement(4065)-g, cdbSNP:200189905
complement(4067)-g, adbSNP:377455498
complement(4069)-g, adbSNP:200364359
complement(4081)-t, cdbSNP:372660293
4097+a, gdbSNP:78422671
complement(4104)-c, adbSNP:376833869
complement(4119)-dbSNP:
complement(4119)-, adbSNP:57012772
complement(4164)-t, cdbSNP:9658500
complement(4188)-t, cdbSNP:202207077
complement(4203)-t, cdbSNP:375187265
complement(4220)-g, adbSNP:372289883
4228+c, tdbSNP:71653609
4231+c, tdbSNP:80312270
complement(4233)-t, cdbSNP:34375182
4243+c, tdbSNP:77074921
complement(4251)-g, adbSNP:200168308
complement(4273)-t, cdbSNP:376645694
complement(4299)-t, cdbSNP:9658501
complement(4309)-t, cdbSNP:367781841
complement(4384)-dbSNP:
complement(4384)-t, cdbSNP:368758207
complement(4387)-t, cdbSNP:374280350
complement(4392)-t, gdbSNP:371026538
complement(4395)-g, cdbSNP:201760168
complement(4444)-dbSNP:
complement(4444)-g, adbSNP:369249262
complement(4569)-dbSNP:
complement(4569)-g, adbSNP:372919678
complement(4577)-t, cdbSNP:199524143
complement(4588)-t, cdbSNP:369884374
complement(4722)-dbSNP:
complement(4722)-t, cdbSNP:371373127
4729+a, gdbSNP:76104785
complement(4736)-t, cdbSNP:374511365
complement(4758)-c, adbSNP:9658533
complement(4762)-t, cdbSNP:377188191
complement(4767)-g, adbSNP:372991443
complement(4768)-g, adbSNP:74427117
complement(4770)-t, gdbSNP:2293044
complement(4779)-g, adbSNP:373366434
complement(4805)-t, cdbSNP:370228558
complement(4845)-t, cdbSNP:190492371
complement(4857)-g, adbSNP:146276987
complement(4892)-dbSNP:
complement(4892)-t, cdbSNP:376113705
complement(4896)-g, adbSNP:267603325
complement(4929)-t, cdbSNP:371535616
4959+a, gdbSNP:9658545
complement(4975)-g, cdbSNP:201476356
complement(4995)-g, cdbSNP:191788603
complement(4998)-g, adbSNP:369277356
complement(5024)-dbSNP:
complement(5024)-t, cdbSNP:9658557
complement(5032)-g, adbSNP:369818679
complement(5056)-t, cdbSNP:377193486
complement(5058)-t, cdbSNP:372696748
complement(5068)-c, adbSNP:368929655
complement(5080)-g, cdbSNP:374929145
complement(5093)-t, gdbSNP:372244034
complement(5104)-c, adbSNP:375556230
complement(5154)-g, adbSNP:188122745
complement(5156)-g, adbSNP:144042938
complement(5236)-t, gdbSNP:183343930
5292+c, tdbSNP:2682826
complement(5324)-t, cdbSNP:3741473
complement(5331)-t, cdbSNP:386624124
complement(5331)-g, adbSNP:9658558
complement(5383)-t, cdbSNP:9658559
complement(5457..5460)-, acagdbSNP:60094430
complement(5457..5458)-, ag, cadbSNP:60470377
complement(5457)-g, cdbSNP:11068415
complement(5467..5468)-, acdbSNP:145880725
complement(5483)-c, adbSNP:192623102
complement(5490..5491)-(tg)20, 21, 22, 23, 24, 26dbSNP:3221882
complement(5491..5492)-, cadbSNP:144158800
complement(5510)-g, adbSNP:139248593
5518+a, tdbSNP:9658560
complement(5610)-g, adbSNP:116103924
complement(5680)-t, cdbSNP:2133681
complement(5780)-g, adbSNP:187527080
complement(5881)-g, adbSNP:41511544
complement(5926)-t, gdbSNP:9658561
complement(5942)-, cdbSNP:139368187
6009+a, gdbSNP:148683456
6073+a, tdbSNP:9658562
complement(6127)-, adbSNP:200320647
6212+g, tdbSNP:144160475
complement(6286)-t, cdbSNP:55848937
complement(6387)-g, adbSNP:9658563
complement(6424)-t, cdbSNP:191201038
complement(6469..6470)-, gdbSNP:200187904
complement(6470)-, gdbSNP:397776730
6472+, cdbSNP:9658564
complement(6479)-t, adbSNP:3937939
complement(6563)-g, adbSNP:149499912
complement(6590)-t, adbSNP:187888090
complement(6651..6653)-ttt, gtadbSNP:386766742
complement(6651)-t, adbSNP:79050955
complement(6653)-t, gdbSNP:76688506
complement(6677)-g, adbSNP:41472247
complement(6681..6682)-, cdbSNP:35032440
complement(6703)-t, cdbSNP:7132722
complement(6703)-g, adbSNP:386607742
6763+a, gdbSNP:9658565
complement(6896)-c, adbSNP:9658566
complement(6903)-t, cdbSNP:386624126
complement(6903)-g, adbSNP:9658567
complement(6938)-g, cdbSNP:139149689
complement(6939)-t, gdbSNP:374624831
complement(6961)-t, adbSNP:9658568
complement(7078)-g, adbSNP:147417836
complement(7088)-t, cdbSNP:143103197
complement(7124)-g, adbSNP:9658569
7257+g, tdbSNP:9658570
complement(7326)-t, cdbSNP:182678396
7348+g, tdbSNP:9658571
complement(7349..7351)-, aatdbSNP:201438460
7350..7352+, tttdbSNP:397843819
7356..7358+, tttdbSNP:9658572
complement(7391)-t, gdbSNP:9658573
complement(7406)-g, adbSNP:9658574
complement(7574)-g, cdbSNP:190966281
complement(7671)-t, cdbSNP:146322728
complement(7760)-t, cdbSNP:185817085
complement(7780)-g, cdbSNP:181477006
7835+a, gdbSNP:9658575
complement(7849)-t, cdbSNP:185893125
7853+a, cdbSNP:141850448
complement(7894..7895)-, gdbSNP:34041352
complement(7930)-t, cdbSNP:113116092
complement(8094)-g, adbSNP:376091885
complement(8133)-g, adbSNP:181503962
complement(8249)-t, adbSNP:11614833
complement(8249)-, adbSNP:63146860
complement(8250..8251)-, a, aaadbSNP:113562322
complement(8250)-t, adbSNP:11615277
complement(8359)-g, adbSNP:189500255
complement(8400)-t, cdbSNP:184655263
complement(8562..8563)-, gdbSNP:34230698
complement(8570)-t, gdbSNP:148157181
complement(8573)-t, cdbSNP:143822731
8662+a, gdbSNP:9658576
complement(8668)-t, cdbSNP:181973345
8683+a, gdbSNP:148968673
complement(8717)-g, adbSNP:373130861
complement(8769)-t, cdbSNP:79836876
complement(8787)-g, adbSNP:377097320
complement(8794)-g, adbSNP:189553587
complement(8835)-g, cdbSNP:184123968
complement(8926)-c, adbSNP:117665273
complement(9006)-g, adbSNP:11616132
9074+a, cdbSNP:146845730
complement(9115)-g, adbSNP:373461623
complement(9119)-t, cdbSNP:111412016
complement(9225)-g, adbSNP:140280164
complement(9359..9360)-, tdbSNP:63278660
complement(9384..9385)-, ttttadbSNP:200856589
complement(9398)-g, cdbSNP:113781886
complement(9412)-g, cdbSNP:146701658
complement(9451)-t, cdbSNP:192931503
complement(9463)-t, cdbSNP:60695198
complement(9478)-t, cdbSNP:187127850
complement(9628)-t, cdbSNP:369901276
complement(9638)-t, gdbSNP:78784523
complement(9746)-t, cdbSNP:184716708
complement(9748)-t, gdbSNP:36016891
complement(9798..9799)-, gdbSNP:34018958
complement(9868)-c, adbSNP:375987172
complement(9913)-t, gdbSNP:192063777
complement(10067)-c, adbSNP:149657692
complement(10109)-g, adbSNP:11068413
complement(10119)-g, cdbSNP:58982059
complement(10147)-g, adbSNP:367815788
complement(10155)-g, adbSNP:111962507
complement(10165..10166)-, ttdbSNP:146442744
complement(10240)-t, gdbSNP:142690571
complement(10273)-t, cdbSNP:184109702
complement(10429)-g, adbSNP:1105026
complement(10727)-g, adbSNP:10774907
complement(10912)-g, adbSNP:117321346
complement(10916)-g, cdbSNP:117860105
complement(10977)-t, cdbSNP:139810727
complement(11025)-t, cdbSNP:10774906
complement(11028)-t, cdbSNP:12425729
complement(11031)-g, adbSNP:61152712
complement(11094)-g, adbSNP:56709211
complement(11179)-t, cdbSNP:147401367
complement(11208)-g, cdbSNP:74567483
complement(11257)-c, adbSNP:73393697
11474+a, gdbSNP:3196412
complement(11518)-t, cdbSNP:140783357
complement(11534)-t, cdbSNP:7308150
complement(11575)-t, gdbSNP:191867506
complement(11595..11596)-, tdbSNP:10644899
complement(11902..11903)-, tgt, tgtgt, tgtgtgtgtgtgt, tgtgtgtgtgtgtgtgdbSNP:58714999
complement(11932..11933)-, gtdbSNP:66886445
complement(11933..11934)-, gt, gtgtgtgtgtgtdbSNP:71444610
Gene SymbolNOS1
Gene SynonymbNOS; IHPS1; N-NOS; NC-NOS; nNOS; NOS
Chromosome12
Locus Map12q24.22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000620 Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 1, mRNA. On-demand $1699.00 25
NM_001204214 Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 4, mRNA. On-demand $1699.00 25
NM_001204218 Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 2, mRNA. On-demand $1699.00 25
NM_001204213 Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant 3, mRNA. On-demand $1699.00 25
XM_006719426 PREDICTED: Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant X1, mRNA. On-demand $1699.00 25
XM_006719427 PREDICTED: Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant X2, mRNA. On-demand $1699.00 25
XM_006719428 PREDICTED: Homo sapiens nitric oxide synthase 1 (neuronal) (NOS1), transcript variant X3, mRNA. On-demand $1699.00 25
Title Nuclear recruitment of neuronal nitric-oxide synthase by alpha-syntrophin is crucial for the induction of mitochondrial biogenesis .
Author Aquilano K, Baldelli S and Ciriolo MR.
Journal J. Biol. Chem. 289 (1), 365-378 (2014)
Title Nitric oxide synthase gene polymorphisms in functional dyspepsia .
Author Park JM, Baeg MK, Lim CH, Cho YK and Choi MG.
Journal Dig. Dis. Sci. 59 (1), 72-77 (2014)
Title Nitric oxide synthase polymorphisms, gene expression and lung function in chronic obstructive pulmonary disease .
Author Aminuddin F, Hackett TL, Stefanowicz D, Saferali A, Pare PD, Gulsvik A, Bakke P, Cho MH, Litonjua A, Lomas DA, Anderson WH, Beaty TH, Silverman EK and Sandford AJ.
Journal BMC Pulm Med 13, 64 (2013)
Title Transcription of different exons 1 of the human neuronal nitric oxide synthase gene is dynamically regulated in a cell- and stimulus-specific manner .
Author Boissel JP, Zelenka M, Godtel-Armbrust U, Feuerstein TJ and Forstermann U.
Journal Biol. Chem. 384 (3), 351-362 (2003)
Title Isolation and characterization of a novel, human neuronal nitric oxide synthase cDNA .
Author Larsson B and Phillips SC.
Journal Biochem. Biophys. Res. Commun. 251 (3), 898-902 (1998)
Title A novel, testis-specific mRNA transcript encoding an NH2-terminal truncated nitric-oxide synthase .
Author Wang Y, Goligorsky MS, Lin M, Wilcox JN and Marsden PA.
Journal J. Biol. Chem. 272 (17), 11392-11401 (1997)
Title Cysteine 99 of endothelial nitric oxide synthase (NOS-III) is critical for tetrahydrobiopterin-dependent NOS-III stability and activity .
Author Chen PF, Tsai AL and Wu KK.
Journal Biochem. Biophys. Res. Commun. 215 (3), 1119-1129 (1995)
Title Localization of brain nitric oxide synthase (NOS) to human chromosome 12 .
Author Kishimoto J, Spurr N, Liao M, Lizhi L, Emson P and Xu W.
Journal Genomics 14 (3), 802-804 (1992)
Title Cloned and expressed macrophage nitric oxide synthase contrasts with the brain enzyme .
Author Lowenstein CJ, Glatt CS, Bredt DS and Snyder SH.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (15), 6711-6715 (1992)
Title Nitric oxide synthase regulatory sites. Phosphorylation by cyclic AMP-dependent protein kinase, protein kinase C, and calcium/calmodulin protein kinase; identification of flavin and calmodulin binding sites .
Author Bredt DS, Ferris CD and Snyder SH.
Journal J. Biol. Chem. 267 (16), 10976-10981 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.