• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nitric oxide synthase 2, inducible (NOS2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000625 Homo sapiens nitric oxide synthase 2, inducible (NOS2), mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_000625.4, 206597519
Length 4206 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens nitric oxide synthase 2, inducible (NOS2), mRNA.
Product nitric oxide synthase, inducible
Comment

Summary: Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008].


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_000616.3
CDS 265..3726
Misc Feature(1)211..213
Misc Feature(2)514..1752
Misc Feature(3)514..1752
Misc Feature(4)order(532..537,568..570,574..576,586..588,592..612,
Misc Feature(5)order(862..864,1051..1053,1303..1305,1369..1374,
Misc Feature(6)1159..1161
Misc Feature(7)1270..1272
Misc Feature(8)1600..1602
Misc Feature(9)1789..1851
Misc Feature(10)1876..3648
Misc Feature(11)1885..2280
Misc Feature(12)2356..2358
Misc Feature(13)2470..3660
Misc Feature(14)order(2578..2580,2980..2991,3034..3042,3088..3099,
Misc Feature(15)order(2980..2982,2986..2991)
Misc Feature(16)order(3088..3090,3097..3099,3106..3108,3124..3126)
Misc Feature(17)order(3199..3201,3211..3222,3226..3228)
Misc Feature(18)order(3214..3219,3307..3315,3511..3516)
Exon (1)1..191
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (2)192..374
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (3)375..459
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (4)460..582
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (5)583..731
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (6)732..894
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (7)895..986
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (8)987..1128
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (9)1129..1268
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (10)1269..1443
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (11)1444..1545
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (12)1546..1740
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (13)1741..1823
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (14)1824..1968
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (15)1969..2073
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (16)2074..2123
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (17)2124..2298
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (18)2299..2431
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (19)2432..2510
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (20)2511..2692
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (21)2693..2856
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (22)2857..3064
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (23)3065..3152
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (24)3153..3274
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (25)3275..3423
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (26)3424..3618
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Exon (27)3619..4206
Gene:NOS2
Gene Synonym:HEP-NOS; INOS; NOS; NOS2A
Translation MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR VAVQPSSLEMSAL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(8)-dbSNP:
complement(8)-g, adbSNP:200690869
complement(10)-g, adbSNP:199582928
complement(14)-c, adbSNP:201628273
complement(18)-g, adbSNP:200787418
complement(19)-t, cdbSNP:199558529
complement(37)-g, adbSNP:201352742
complement(38)-g, cdbSNP:10459953
complement(53)-t, adbSNP:202243635
complement(66)-t, cdbSNP:201542005
complement(75)-g, adbSNP:200224161
complement(91)-t, cdbSNP:202013910
complement(92)-c, adbSNP:201236817
complement(117)-g, adbSNP:200150325
complement(157)-g, adbSNP:201678225
complement(160)-g, adbSNP:200880588
complement(165)-g, adbSNP:199972775
complement(166)-t, cdbSNP:201984101
complement(178)-t, gdbSNP:200863138
complement(187)-t, cdbSNP:199868193
complement(201)-dbSNP:
complement(201)-t, cdbSNP:200515233
complement(222)-t, gdbSNP:192075464
complement(230)-t, cdbSNP:186549885
complement(245)-g, adbSNP:201123212
complement(248)-t, adbSNP:200335563
complement(269)-g, adbSNP:147921664
complement(307)-g, adbSNP:200972060
complement(324)-t, cdbSNP:200311892
complement(334)-t, cdbSNP:202010508
complement(357)-t, cdbSNP:3730014
complement(366)-g, adbSNP:145012201
complement(370)-t, adbSNP:200154122
complement(377)-dbSNP:
complement(377)-g, cdbSNP:150367182
complement(378)-t, cdbSNP:187393330
complement(381)-t, cdbSNP:200895544
complement(382)-t, cdbSNP:199791588
complement(399)-t, cdbSNP:201239372
complement(409)-g, adbSNP:200186047
complement(444)-g, adbSNP:199659914
complement(445)-t, cdbSNP:201165915
complement(452)-g, adbSNP:141421929
complement(466)-dbSNP:
complement(466)-g, adbSNP:201113904
complement(468)-t, cdbSNP:16966563
complement(490)-g, cdbSNP:201388779
complement(510)-t, cdbSNP:201900757
complement(511)-g, adbSNP:200696035
complement(513)-c, adbSNP:199582562
complement(516)-g, adbSNP:145346921
complement(541)-t, cdbSNP:201531558
complement(554)-t, cdbSNP:139912863
complement(561)-t, adbSNP:28730832
complement(564)-g, adbSNP:142350864
complement(615)-dbSNP:
complement(615)-t, cdbSNP:201971823
complement(619)-t, cdbSNP:201073549
complement(632)-t, cdbSNP:200094552
complement(635)-t, g, cdbSNP:148763708
complement(641)-g, adbSNP:144347687
complement(663)-g, c, adbSNP:199910913
complement(691)-t, cdbSNP:201477644
complement(717)-g, adbSNP:200798874
complement(751)-dbSNP:
complement(751)-g, adbSNP:150574836
complement(767)-g, adbSNP:199555157
complement(809)-g, adbSNP:149623743
complement(822)-g, adbSNP:139747007
complement(823)-t, cdbSNP:200394633
complement(828)-g, adbSNP:202174825
complement(837)-c, adbSNP:201721294
complement(848)-t, cdbSNP:200238137
complement(895)-dbSNP:
complement(895)-t, cdbSNP:201956840
complement(907)-g, adbSNP:200726416
complement(908)-t, g, cdbSNP:199832362
complement(910)-t, cdbSNP:146407690
complement(915)-g, adbSNP:200497402
complement(925)-t, cdbSNP:3730017
complement(932)-g, adbSNP:201476803
complement(942)-g, adbSNP:200608917
complement(945)-g, cdbSNP:138529021
complement(954)-t, g, adbSNP:201569440
complement(955)-t, cdbSNP:200332233
complement(958)-g, adbSNP:201800461
complement(959)-t, cdbSNP:150106532
complement(989)-dbSNP:
complement(989)-g, adbSNP:199928962
complement(999)-g, adbSNP:201758824
complement(1002)-t, cdbSNP:200789497
complement(1012)-g, adbSNP:141690665
complement(1014)-t, cdbSNP:199551669
complement(1029)-g, adbSNP:201952222
complement(1036)-g, adbSNP:148016612
complement(1037)-t, cdbSNP:199827701
complement(1039)-t, cdbSNP:143537629
complement(1055)-g, adbSNP:113780454
complement(1060)-g, adbSNP:201545022
complement(1065)-g, adbSNP:200184224
complement(1078)-t, adbSNP:141379223
complement(1086)-g, adbSNP:201163153
complement(1113)-g, adbSNP:200761874
complement(1131)-dbSNP:
complement(1131)-t, cdbSNP:200217776
complement(1138)-t, cdbSNP:201644791
complement(1157)-t, cdbSNP:200688826
complement(1158)-t, cdbSNP:199579024
complement(1165)-g, adbSNP:201529188
complement(1166)-t, cdbSNP:200678947
complement(1171)-t, cdbSNP:199575619
complement(1181)-g, cdbSNP:201126397
complement(1188)-g, adbSNP:200809391
complement(1204)-g, adbSNP:147847330
complement(1205)-t, cdbSNP:201540655
complement(1221)-g, adbSNP:34719207
complement(1239)-g, adbSNP:202013637
complement(1270)-dbSNP:
complement(1270)-g, adbSNP:202005766
complement(1272)-g, adbSNP:201009155
complement(1273)-t, cdbSNP:141497943
complement(1275)-t, cdbSNP:202206598
complement(1282)-g, adbSNP:201238156
complement(1291)-t, cdbSNP:199863768
complement(1294)-g, adbSNP:200585666
complement(1305)-g, adbSNP:201471682
complement(1306)-t, cdbSNP:200623027
complement(1320)-g, cdbSNP:145721811
complement(1341)-t, cdbSNP:149790119
complement(1344)-g, adbSNP:140983392
complement(1365)-g, adbSNP:200682910
complement(1381)-c, adbSNP:199574168
complement(1383)-g, adbSNP:201620835
complement(1392)-t, gdbSNP:200897571
complement(1396)-t, cdbSNP:199552625
complement(1398)-t, g, adbSNP:151070816
complement(1399)-t, cdbSNP:200391593
complement(1406)-t, cdbSNP:202095852
complement(1419)-t, cdbSNP:1137933
complement(1434)-g, adbSNP:200310034
complement(1467)-dbSNP:
complement(1467)-t, cdbSNP:139727720
complement(1473)-t, cdbSNP:201958569
complement(1480)-t, gdbSNP:199829544
complement(1483)-t, cdbSNP:146382524
complement(1488)-t, cdbSNP:143922742
complement(1504)-g, cdbSNP:199625453
complement(1507)-t, cdbSNP:139794069
complement(1530)-t, g, adbSNP:28999379
complement(1536)-g, adbSNP:140424684
complement(1572)-dbSNP:
complement(1572)-g, adbSNP:201799438
complement(1578)-t, cdbSNP:149464994
complement(1595)-g, adbSNP:200963583
complement(1618)-g, adbSNP:137979503
complement(1619)-t, cdbSNP:112588673
complement(1625)-t, cdbSNP:201281278
complement(1637)-g, adbSNP:200193371
complement(1638)-t, cdbSNP:142783060
complement(1641)-t, cdbSNP:138830499
complement(1646)-t, cdbSNP:200937263
complement(1666)-t, cdbSNP:199924341
complement(1682)-g, adbSNP:201786442
complement(1713)-g, adbSNP:200787576
complement(1714)-t, cdbSNP:199558669
complement(1725)-g, adbSNP:201695469
complement(1773)-dbSNP:
complement(1773)-g, adbSNP:201161495
complement(1780)-g, adbSNP:146104261
complement(1781)-g, adbSNP:3729717
complement(1801)-, tdbSNP:56232443
complement(1804)-t, gdbSNP:149591539
complement(1810)-t, cdbSNP:200388007
complement(1852)-dbSNP:
complement(1852)-g, c, adbSNP:148070104
complement(1866)-t, cdbSNP:200136687
complement(1919)-g, adbSNP:143226463
complement(1920)-t, cdbSNP:200599830
complement(1939)-c, adbSNP:149150822
complement(1979)-dbSNP:
complement(1979)-g, adbSNP:202189900
complement(1980..1981)-, cdbSNP:34517795
complement(2014)-g, adbSNP:201443307
complement(2019)-g, c, adbSNP:28999412
complement(2039)-g, adbSNP:202001885
complement(2040)-t, cdbSNP:201002421
complement(2071)-t, cdbSNP:199992826
complement(2079)-dbSNP:
complement(2079)-t, cdbSNP:201473277
complement(2087)-g, adbSNP:2297518
complement(2105)-t, cdbSNP:200018254
complement(2131)-dbSNP:
complement(2131)-g, cdbSNP:202188540
complement(2142)-g, adbSNP:201137209
complement(2143)-t, cdbSNP:200595665
complement(2154)-g, cdbSNP:201702258
complement(2161)-g, adbSNP:200750597
complement(2169)-g, adbSNP:202098132
complement(2170)-t, cdbSNP:201531464
complement(2228)-g, adbSNP:183645530
complement(2231)-g, adbSNP:199861578
complement(2265)-g, adbSNP:144098330
complement(2272)-g, adbSNP:200815966
complement(2283)-g, adbSNP:140648818
complement(2300)-dbSNP:
complement(2300)-t, gdbSNP:200602347
complement(2306)-t, cdbSNP:199536608
complement(2313)-t, cdbSNP:201563543
complement(2317)-g, cdbSNP:3730230
complement(2323)-t, g, adbSNP:200336122
complement(2334)-t, cdbSNP:201798721
complement(2354)-g, adbSNP:185634308
complement(2366)-t, cdbSNP:146852100
complement(2367)-t, adbSNP:200202814
complement(2381)-g, adbSNP:201789784
complement(2382)-g, adbSNP:28944168
complement(2402)-t, gdbSNP:200789218
complement(2407)-t, adbSNP:200216266
complement(2422)-g, adbSNP:143835443
complement(2457)-dbSNP:
complement(2457)-g, adbSNP:139962252
complement(2460)-t, cdbSNP:199553039
complement(2466)-g, adbSNP:201719111
complement(2468)-g, adbSNP:200808004
complement(2483)-t, cdbSNP:199682298
complement(2495)-t, cdbSNP:201537561
complement(2503)-g, adbSNP:28944173
complement(2513)-dbSNP:
complement(2513)-t, cdbSNP:150704221
complement(2536)-t, adbSNP:199866556
complement(2568)-c, adbSNP:202058560
complement(2591)-c, adbSNP:201105235
complement(2609)-g, adbSNP:144057872
complement(2622)-t, cdbSNP:1060822
complement(2632)-g, adbSNP:200642364
complement(2641)-t, cdbSNP:199958711
complement(2655)-g, adbSNP:201998157
complement(2659)-g, cdbSNP:200708979
complement(2668)-g, adbSNP:199559192
complement(2677)-c, adbSNP:201795332
complement(2678)-t, gdbSNP:199892476
complement(2707)-dbSNP:
complement(2707)-t, cdbSNP:201679949
complement(2740)-g, adbSNP:200436931
complement(2771)-g, adbSNP:201999889
complement(2778)-t, gdbSNP:144469559
complement(2809)-c, adbSNP:142764405
complement(2812)-t, cdbSNP:138793535
complement(2821)-t, cdbSNP:202194391
complement(2885)-dbSNP:
complement(2885)-g, adbSNP:201611859
complement(2924)-t, g, adbSNP:200892252
complement(2925)-t, cdbSNP:145472296
complement(2932)-g, adbSNP:201381506
complement(2971)-g, cdbSNP:147189338
complement(3005)-t, cdbSNP:200386224
complement(3014)-g, adbSNP:199686103
complement(3021)-g, adbSNP:1060826
complement(3033)-t, cdbSNP:138086040
complement(3049)-t, gdbSNP:200171138
complement(3052)-g, adbSNP:202029754
complement(3056)-t, adbSNP:201282647
complement(3073)-dbSNP:
complement(3073)-t, cdbSNP:199912374
complement(3076)-g, adbSNP:201696806
complement(3085)-g, adbSNP:150387129
complement(3090)-t, cdbSNP:1060828
complement(3116)-g, adbSNP:199784125
complement(3119)-t, cdbSNP:140914849
complement(3121)-g, cdbSNP:200519404
complement(3127)-g, cdbSNP:199615428
complement(3132)-t, cdbSNP:201443807
complement(3139)-g, adbSNP:200549600
complement(3156)-dbSNP:
complement(3156)-g, c, adbSNP:28944200
complement(3160)-t, cdbSNP:148088114
complement(3173)-g, cdbSNP:199549623
complement(3177)-g, cdbSNP:145672724
complement(3218)-t, cdbSNP:199511411
complement(3225)-t, c, adbSNP:201753717
complement(3228)-g, adbSNP:200921564
complement(3233)-t, cdbSNP:199658151
complement(3249)-t, cdbSNP:140597391
complement(3265)-g, adbSNP:201718531
complement(3273)-t, cdbSNP:200646693
complement(3289)-dbSNP:
complement(3289)-t, cdbSNP:28944201
complement(3293)-g, adbSNP:201338419
complement(3294)-c, adbSNP:199862460
complement(3315)-g, cdbSNP:145106954
complement(3316)-t, gdbSNP:149201685
complement(3330)-g, adbSNP:201131338
complement(3355)-t, cdbSNP:200133617
complement(3373)-g, cdbSNP:145383683
complement(3379)-g, adbSNP:201643030
complement(3383)-g, adbSNP:150061937
complement(3410)-g, adbSNP:200020109
complement(3424)-dbSNP:
complement(3424)-t, cdbSNP:141722139
complement(3438)-g, adbSNP:199962301
complement(3444)-t, cdbSNP:201492456
complement(3445)-g, adbSNP:200470759
complement(3446)-t, cdbSNP:201995183
complement(3462)-g, c, adbSNP:139005303
complement(3473)-c, adbSNP:199927159
complement(3499)-g, adbSNP:202086662
complement(3503)-t, cdbSNP:201643873
complement(3510)-g, adbSNP:201378393
complement(3520)-g, adbSNP:113419464
complement(3521)-t, cdbSNP:199859783
complement(3529)-g, adbSNP:201947529
complement(3534)-g, adbSNP:144240446
complement(3535)-t, cdbSNP:200807678
complement(3556)-g, adbSNP:57688726
complement(3588)-t, cdbSNP:140381074
complement(3594)-t, cdbSNP:3729662
complement(3597)-t, cdbSNP:141730458
complement(3598)-t, cdbSNP:188223236
complement(3617)-t, gdbSNP:200408744
complement(3636)-dbSNP:
complement(3636)-t, cdbSNP:1137949
complement(3666)-g, adbSNP:202197158
complement(3669)-t, cdbSNP:201124699
complement(3671)-g, adbSNP:200632738
complement(3672)-t, cdbSNP:7223110
complement(3682)-t, cdbSNP:144577286
complement(3689)-g, adbSNP:200748226
complement(3691)-t, cdbSNP:149327839
complement(3712)-t, cdbSNP:199748579
complement(3719)-g, adbSNP:199955383
complement(3722)-g, adbSNP:201526410
complement(3730)-g, adbSNP:200988116
complement(3739)-g, cdbSNP:199920549
complement(3748)-c, adbSNP:201974745
complement(3768)-g, cdbSNP:200804749
complement(3782)-g, adbSNP:199679629
complement(3792)-t, cdbSNP:3201742
complement(3806)-g, adbSNP:200522878
complement(3826)-t, cdbSNP:199617035
complement(3843)-t, gdbSNP:184843187
complement(3847)-g, adbSNP:201443582
complement(3855)-g, adbSNP:200438857
complement(3856)-g, cdbSNP:199565254
complement(3860)-g, cdbSNP:201550339
complement(3895)-t, gdbSNP:200328556
complement(3917)-g, adbSNP:191602472
complement(3918)-t, cdbSNP:201007609
complement(3922)-g, adbSNP:200198698
complement(3939)-t, cdbSNP:201789241
complement(3950)-t, cdbSNP:200960935
complement(3963)-g, adbSNP:15782
complement(3974)-g, adbSNP:200208380
complement(3978)-t, cdbSNP:201855303
complement(4002)-g, adbSNP:28944214
complement(4006)-g, adbSNP:199960218
complement(4033)-t, cdbSNP:201780365
complement(4050)-g, adbSNP:28944215
complement(4053)-g, adbSNP:28944216
complement(4079)-g, adbSNP:144004051
complement(4118)-g, adbSNP:200737669
complement(4122)-t, cdbSNP:199675913
complement(4133)-t, cdbSNP:201533355
complement(4136)-t, cdbSNP:200703296
complement(4141)-t, cdbSNP:28944217
complement(4144)-t, cdbSNP:188748017
complement(4145)-g, cdbSNP:201193300
complement(4156)-t, cdbSNP:200401074
complement(4167)-t, adbSNP:201701932
complement(4172)-c, adbSNP:201027622
complement(4181)-t, cdbSNP:200322682
complement(4185)-t, cdbSNP:202215159
complement(4200)-t, cdbSNP:201230395
Gene SymbolNOS2
Gene SynonymHEP-NOS; INOS; NOS; NOS2A
Chromosome17
Locus Map17q11.2-q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000625 Homo sapiens nitric oxide synthase 2, inducible (NOS2), mRNA. On-demand $1699.00 25
Title Loss of methylation in CpG sites in the NF-kappaB enhancer elements of inducible nitric oxide synthase is responsible for gene induction in human articular chondrocytes .
Author de Andres,M.C., Imagawa,K., Hashimoto,K., Gonzalez,A., Roach,H.I., Goldring,M.B. and Oreffo,R.O.
Journal Arthritis Rheum. 65 (3), 732-742 (2013)
Title A non-synonymous SNP in the NOS2 associated with septic shock in patients with sepsis in Chinese populations .
Author Wang,Z., Feng,K., Yue,M., Lu,X., Zheng,Q., Zhang,H., Zhai,Y., Li,P., Yu,L., Cai,M., Zhang,X., Kang,X., Shi,W., Xia,X., Chen,X., Cao,P., Li,Y., Chen,H., Ling,Y., Li,Y., He,F. and Zhou,G.
Journal Hum. Genet. 132 (3), 337-346 (2013)
Title Inducible nitric oxide synthase haplotype associated with hypertension and responsiveness to antihypertensive drug therapy .
Author Oliveira-Paula,G.H., Lacchini,R., Coeli-Lacchini,F.B., Junior,H.M. and Tanus-Santos,J.E.
Journal Gene 515 (2), 391-395 (2013)
Title Inducible nitric oxide synthetase genotype and Helicobacter pylori infection affect gastric cancer risk .
Author Rafiei,A., Hosseini,V., Janbabai,G., Fazli,B., Ajami,A., Hosseini-Khah,Z., Gilbreath,J. and Merrell,D.S.
Journal World J. Gastroenterol. 18 (35), 4917-4924 (2012)
Title Production of nitric oxide is lower in Shiga toxin-stimulated neutrophils of infants compared to those of children or adults .
Author Tsuji,S., Iharada,A., Kimata,T., Shimo,T., Hirabayashi,M. and Kaneko,K.
Journal Tohoku J. Exp. Med. 228 (3), 247-252 (2012)
Title Constitutive and inducible nitric oxide synthase gene expression, regulation, and activity in human lung epithelial cells .
Author Asano,K., Chee,C.B., Gaston,B., Lilly,C.M., Gerard,C., Drazen,J.M. and Stamler,J.S.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (21), 10089-10093 (1994)
Title Inducible nitric oxide synthase from human articular chondrocytes: cDNA cloning and analysis of mRNA expression .
Author Maier,R., Bilbe,G., Rediske,J. and Lotz,M.
Journal Biochim. Biophys. Acta 1208 (1), 145-150 (1994)
Title Molecular cloning, structure, and chromosomal localization of the human inducible nitric oxide synthase gene .
Author Chartrain,N.A., Geller,D.A., Koty,P.P., Sitrin,N.F., Nussler,A.K., Hoffman,E.P., Billiar,T.R., Hutchinson,N.I. and Mudgett,J.S.
Journal J. Biol. Chem. 269 (9), 6765-6772 (1994)
Title Localization of the human gene for inducible nitric oxide synthase (NOS2) to chromosome 17q11.2-q12 .
Author Marsden,P.A., Heng,H.H., Duff,C.L., Shi,X.M., Tsui,L.C. and Hall,A.V.
Journal Genomics 19 (1), 183-185 (1994)
Title Cloning, characterization, and expression of a cDNA encoding an inducible nitric oxide synthase from the human chondrocyte .
Author Charles,I.G., Palmer,R.M., Hickery,M.S., Bayliss,M.T., Chubb,A.P., Hall,V.S., Moss,D.W. and Moncada,S.
Journal Proc. Natl. Acad. Sci. U.S.A. 90 (23), 11419-11423 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.