Homo sapiens nitric oxide synthase 2, inducible (NOS2), mRNA.
| RefSeq Version | NM_000625.4, 206597519 |
| Length | 4206 bp |
| Structure | linear |
| Update Date | 09-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens nitric oxide synthase 2, inducible (NOS2), mRNA. |
| Product | nitric oxide synthase, inducible |
| Comment | Summary: Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. |
| RefSeq | NP_000616.3 |
| CDS | 265..3726 | Exon (1) | 1..191 | Exon (2) | 1..191 | Exon (3) | 192..374 | Exon (4) | 375..459 | Exon (5) | 460..582 | Exon (6) | 583..731 | Exon (7) | 732..894 | Exon (8) | 895..986 | Exon (9) | 987..1128 | Exon (10) | 1129..1268 | Exon (11) | 1269..1443 | Exon (12) | 1444..1545 | Exon (13) | 1546..1740 | Exon (14) | 1741..1823 | Exon (15) | 1824..1968 | Exon (16) | 1969..2073 | Exon (17) | 2074..2123 | Exon (18) | 2124..2298 | Exon (19) | 2299..2431 | Exon (20) | 2432..2510 | Exon (21) | 2511..2692 | Exon (22) | 2693..2856 | Exon (23) | 2857..3064 | Exon (24) | 3065..3152 | Exon (25) | 3153..3274 | Exon (26) | 3275..3423 | Exon (27) | 3424..3618 | Exon (28) | 3619..4206 |
| Translation | MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL
VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY
VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR
VAVQPSSLEMSAL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(38) | - | g, c | dbSNP:10459953 |
| complement(222) | - | t, g | dbSNP:75029228 |
| 357 | + | c, t | dbSNP:3730014 |
| complement(468) | - | t, c | dbSNP:16966563 |
| 561 | + | a, t | dbSNP:28730832 |
| 925 | + | c, t | dbSNP:3730017 |
| complement(1055) | - | g, a | dbSNP:113780454 |
| complement(1221) | - | g, a | dbSNP:34719207 |
| 1419 | + | c, t | dbSNP:1137933 |
| 1530 | + | g, t | dbSNP:28999379 |
| complement(1619) | - | t, c | dbSNP:112588673 |
| 1781 | + | a, g | dbSNP:3729717 |
| complement(1801) | - | , t | dbSNP:56232443 |
| complement(1979..1980) | - | , c | dbSNP:34517795 |
| 2019 | + | a, g | dbSNP:28999412 |
| complement(2087) | - | g, a | dbSNP:2297518 |
| 2317 | + | c, g | dbSNP:3730230 |
| 2382 | + | a, g | dbSNP:28944168 |
| 2503 | + | a, g | dbSNP:28944173 |
| 2622 | + | c, t | dbSNP:1060822 |
| complement(2777) | - | , t | dbSNP:66472911 |
| complement(2821) | - | t, c | dbSNP:2314808 |
| complement(2833) | - | , t | dbSNP:68042259 |
| 3021 | + | a, g | dbSNP:1060826 |
| 3090 | + | c, t | dbSNP:1060828 |
| 3156 | + | c, g | dbSNP:28944200 |
| 3289 | + | c, t | dbSNP:28944201 |
| complement(3520) | - | g, a | dbSNP:113419464 |
| complement(3556) | - | g, a | dbSNP:57688726 |
| complement(3594) | - | g, a | dbSNP:75831953 |
| 3594 | + | c, t | dbSNP:3729662 |
| 3636 | + | c, t | dbSNP:1137949 |
| complement(3672) | - | t, c | dbSNP:7223110 |
| 3792 | + | c, t | dbSNP:3201742 |
| 3963 | + | a, g | dbSNP:15782 |
| 4002 | + | a, g | dbSNP:28944214 |
| 4050 | + | a, g | dbSNP:28944215 |
| 4053 | + | a, g | dbSNP:28944216 |
| 4141 | + | c, t | dbSNP:28944217 |
| Gene Symbol | NOS2 |
| Gene Synonym | HEP-NOS; INOS; NOS; NOS2A |
| Chromosome | 17 |
| Locus Map | 17q11.2-q12 |
| All Transcripts | NM_000625 |
| Title | DeltaNp63alpha/IRF6 interplay activates NOS2 transcription and induces autophagy upon tobacco exposure . |
| Author | Ratovitski,E.A. |
| Journal | Arch. Biochem. Biophys. 506 (2), 208-215 (2011) |
| Title | Identification of genetic factors associated with susceptibility to angiotensin-converting enzyme inhibitors-induced cough . |
| Author | Grilo,A., Saez-Rosas,M.P., Santos-Morano,J., Sanchez,E., Moreno-Rey,C., Real,L.M., Ramirez-Lorca,R. and Saez,M.E. |
| Journal | Pharmacogenet. Genomics 21 (1), 10-17 (2011) |
| Title | Diabetic retinopathy: Validation study of ALR2, RAGE, iNOS and TNFB gene variants in a south Indian cohort . |
| Author | Uthra,S., Raman,R., Mukesh,B.N., Rajkumar,S.A., Kumari,P., Lakshmipathy,P., Gnanamoorthy,P., Sharma,T., McCarty,C.A. and Kumaramanickavel,G. |
| Journal | Ophthalmic Genet. 31 (4), 244-251 (2010) |
| Title | Inducible nitric oxide synthase (iNOS) gene polymorphism and disease prevalence . |
| Author | Qidwai,T. and Jamal,F. |
| Journal | Scand. J. Immunol. 72 (5), 375-387 (2010) |
| Title | Inflammation gene variants and susceptibility to albuminuria in the U.S. population: analysis in the Third National Health and Nutrition Examination Survey (NHANES III), 1991-1994 . |
| Author | Ned,R.M., Yesupriya,A., Imperatore,G., Smelser,D.T., Moonesinghe,R., Chang,M.H. and Dowling,N.F. |
| Journal | BMC Med. Genet. 11, 155 (2010) |
| Title | Constitutive and inducible nitric oxide synthase gene expression, regulation, and activity in human lung epithelial cells . |
| Author | Asano,K., Chee,C.B., Gaston,B., Lilly,C.M., Gerard,C., Drazen,J.M. and Stamler,J.S. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 91 (21), 10089-10093 (1994) |
| Title | Inducible nitric oxide synthase from human articular chondrocytes: cDNA cloning and analysis of mRNA expression . |
| Author | Maier,R., Bilbe,G., Rediske,J. and Lotz,M. |
| Journal | Biochim. Biophys. Acta 1208 (1), 145-150 (1994) |
| Title | Molecular cloning, structure, and chromosomal localization of the human inducible nitric oxide synthase gene . |
| Author | Chartrain,N.A., Geller,D.A., Koty,P.P., Sitrin,N.F., Nussler,A.K., Hoffman,E.P., Billiar,T.R., Hutchinson,N.I. and Mudgett,J.S. |
| Journal | J. Biol. Chem. 269 (9), 6765-6772 (1994) |
| Title | Localization of the human gene for inducible nitric oxide synthase (NOS2) to chromosome 17q11.2-q12 . |
| Author | Marsden,P.A., Heng,H.H., Duff,C.L., Shi,X.M., Tsui,L.C. and Hall,A.V. |
| Journal | Genomics 19 (1), 183-185 (1994) |
| Title | Cloning, characterization, and expression of a cDNA encoding an inducible nitric oxide synthase from the human chondrocyte . |
| Author | Charles,I.G., Palmer,R.M., Hickery,M.S., Bayliss,M.T., Chubb,A.P., Hall,V.S., Moss,D.W. and Moncada,S. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 90 (23), 11419-11423 (1993) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |