• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens B-cell CLL/lymphoma 2 (BCL2), transcript variant alpha, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25505 Homo sapiens B-cell CLL/lymphoma 2 (BCL2), transcript variant alpha, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu25505C Homo sapiens B-cell CLL/lymphoma 2 (BCL2), transcript variant alpha, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000633.2, 72198188
Length 720 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens B-cell CLL/lymphoma 2 (BCL2), transcript variant alpha, mRNA.
Product apoptosis regulator Bcl-2 alpha isoform
Comment

Summary: This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (alpha) represents the longer transcript and encodes the longer isoform (alpha).

RefSeq NP_000624.2
CDS 494..1213
Misc Feature(1)375..410
Misc Feature(2)392..394
Misc Feature(3)494..1210
Misc Feature(4)494..1210
Misc Feature(5)512..592
Misc Feature(6)521..583
Misc Feature(7)563..565
Misc Feature(8)593..598
Misc Feature(9)593..595
Misc Feature(10)659..661
Misc Feature(11)698..700
Misc Feature(12)698..700
Misc Feature(13)701..703
Misc Feature(14)701..703
Misc Feature(15)701..703
Misc Feature(16)713..715
Misc Feature(17)749..1096
Misc Feature(18)752..754
Misc Feature(19)752..754
Misc Feature(20)752..754
Misc Feature(21)770..814
Misc Feature(22)782..808
Misc Feature(23)order(791..796,800..805,815..817,824..829,875..880,
Misc Feature(24)899..958
Misc Feature(25)order(899..907,917..955)
Misc Feature(26)1052..1099
Misc Feature(27)1052..1096
Misc Feature(28)1127..1192
Exon (1)1..207
Gene:BCL2
Gene Synonym:Bcl-2; PPP1R50
Exon (2)208..1078
Gene:BCL2
Gene Synonym:Bcl-2; PPP1R50
Exon (3)1079..6492
Gene:BCL2
Gene Synonym:Bcl-2; PPP1R50
Translation MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(18..19)-dbSNP:
complement(18..19)-, tdbSNP:34360708
65+c, gdbSNP:1473418
complement(71)-g, cdbSNP:192114822
complement(123)-c, adbSNP:34223591
complement(201..202)-, tdbSNP:370967917
complement(361)-g, adbSNP:55805819
complement(452)-g, adbSNP:114373512
complement(493)-t, cdbSNP:193014588
514+a, gdbSNP:1801018
complement(514)-t, cdbSNP:386545611
620+a, gdbSNP:1800477
complement(630)-g, adbSNP:369277721
complement(632)-t, cdbSNP:368344129
complement(640)-g, adbSNP:200972039
complement(706)-t, cdbSNP:376115863
complement(738)-g, adbSNP:201827119
complement(741)-t, cdbSNP:375594294
complement(776)-g, adbSNP:373889054
complement(793)-g, adbSNP:61733416
complement(858)-g, adbSNP:373065228
complement(863)-g, adbSNP:61733415
complement(952)-g, adbSNP:137945099
complement(990)-g, adbSNP:201085318
complement(1012)-g, adbSNP:368944844
complement(1069)-g, adbSNP:376214839
complement(1094)-g, adbSNP:143441810
complement(1100)-t, cdbSNP:148811059
complement(1113)-t, cdbSNP:369294037
complement(1157)-t, cdbSNP:113163226
complement(1191)-t, cdbSNP:376149674
complement(1202)-t, cdbSNP:138465313
complement(1215)-t, cdbSNP:373385925
complement(1230)-g, cdbSNP:375217502
complement(1235)-t, gdbSNP:200716283
complement(1257)-t, cdbSNP:371826692
complement(1363)-t, gdbSNP:190262124
complement(1373..1374)-, tgdbSNP:140093696
complement(1427)-, cdbSNP:367997054
1471+a, tdbSNP:4987842
complement(1530)-g, adbSNP:4987843
complement(1530)-g, adbSNP:386597113
complement(1537)-t, adbSNP:185016407
complement(1578)-c, adbSNP:116616724
complement(1624)-g, adbSNP:367947421
complement(1734)-t, gdbSNP:113379949
complement(1753)-c, adbSNP:41301945
complement(1757..1758)-, cdbSNP:374834586
complement(1779)-g, adbSNP:377403870
complement(1798)-c, adbSNP:4987844
complement(1841)-t, cdbSNP:191858049
complement(1880)-t, cdbSNP:3744937
1883+a, gdbSNP:4987845
complement(1883)-t, cdbSNP:386597114
complement(1890)-t, cdbSNP:3744936
complement(1893)-g, adbSNP:4987846
complement(1893)-g, adbSNP:386597115
complement(1943)-t, cdbSNP:150966214
complement(1997)-g, adbSNP:1016860
complement(2050)-g, adbSNP:4987847
2108+c, tdbSNP:141174596
complement(2118)-t, cdbSNP:116117134
2155+a, gdbSNP:4987848
complement(2155)-g, adbSNP:386597116
complement(2257)-g, adbSNP:371590615
2278+c, tdbSNP:2078303
complement(2302)-t, cdbSNP:144527240
complement(2391)-t, cdbSNP:3744935
complement(2391)-t, cdbSNP:386585308
complement(2399)-t, gdbSNP:4987849
complement(2417)-t, cdbSNP:386538314
complement(2417)-g, adbSNP:1564483
complement(2505)-g, adbSNP:145009492
complement(2506)-t, cdbSNP:369042063
complement(2526)-g, adbSNP:187455180
complement(2555)-g, adbSNP:4987850
complement(2568)-t, gdbSNP:149940394
complement(2592)-t, cdbSNP:139755068
2658+a, gdbSNP:1050618
complement(2670)-t, gdbSNP:371452924
2678+c, tdbSNP:150653783
complement(2747..2748)-, tdbSNP:202112192
complement(2784)-g, adbSNP:181495000
complement(2794)-t, adbSNP:180847268
complement(2795)-t, adbSNP:113207678
complement(2803)-, tdbSNP:5825508
complement(2812)-t, cdbSNP:386597117
complement(2812)-g, adbSNP:4987851
complement(3041..3042)-, adbSNP:369915593
complement(3111)-g, adbSNP:374062303
complement(3142)-t, cdbSNP:184698169
complement(3150)-t, cdbSNP:386597118
complement(3150)-g, adbSNP:4987852
complement(3249)-g, adbSNP:181211289
3319+a, gdbSNP:142756703
complement(3320)-t, cdbSNP:139528731
complement(3375)-t, cdbSNP:188797102
complement(3406)-g, adbSNP:373487515
3416+a, gdbSNP:4987853
complement(3416)-t, cdbSNP:386597119
complement(3445)-g, adbSNP:4987854
complement(3522)-t, cdbSNP:386597120
complement(3522)-g, adbSNP:4987855
complement(3550)-t, cdbSNP:117640948
3577+a, gdbSNP:4987856
complement(3624)-g, adbSNP:146379399
complement(3627)-t, cdbSNP:4987857
complement(3654)-t, gdbSNP:142265965
complement(3741)-t, cdbSNP:148341476
complement(3840)-g, adbSNP:17070680
complement(4033)-c, adbSNP:375734256
complement(4054)-, adbSNP:374357488
complement(4097)-g, adbSNP:183691931
complement(4277)-t, cdbSNP:4987858
4393+a, gdbSNP:137980414
complement(4396)-g, adbSNP:41306972
complement(4411)-g, adbSNP:377487726
4414+a, gdbSNP:4987859
4484+a, gdbSNP:4987860
complement(4507)-t, cdbSNP:4987861
complement(4519)-g, adbSNP:188618198
4594+g, tdbSNP:146967889
4724+a, gdbSNP:141080340
complement(4725)-c, adbSNP:147777348
4764+a, gdbSNP:4987862
complement(4771)-g, adbSNP:185704013
complement(4790)-g, adbSNP:193151005
complement(4850)-g, adbSNP:200305018
complement(4885..4890)-, gagtttdbSNP:370395757
complement(4897)-t, adbSNP:146086350
complement(4926..4927)-, cdbSNP:142611734
complement(4932..4935)-, gtctdbSNP:374368978
complement(4988)-t, cdbSNP:187334313
4994+g, tdbSNP:4987863
complement(5118)-g, adbSNP:183000521
complement(5163)-g, adbSNP:140875276
5175+c, tdbSNP:45520140
complement(5183)-t, cdbSNP:77530335
complement(5184..5185)-, adbSNP:372843127
complement(5184..5185)-, adbSNP:386365304
complement(5184)-t, adbSNP:76721111
complement(5190..5191)-, adbSNP:386387940
complement(5194..5195)-, adbSNP:34811186
complement(5194)-t, adbSNP:113158648
complement(5195)-t, adbSNP:77938688
complement(5305)-t, gdbSNP:375819800
complement(5337)-t, gdbSNP:4987864
complement(5438)-t, cdbSNP:371518171
complement(5513)-g, adbSNP:370035615
complement(5514)-g, adbSNP:4987865
complement(5567)-t, adbSNP:190011740
5601+, adbSNP:45489598
complement(5697)-, adbSNP:376082112
complement(5745)-t, adbSNP:45468492
5750+a, gdbSNP:4987866
complement(5856)-g, adbSNP:187081713
complement(5905)-t, cdbSNP:142616439
complement(5999)-g, adbSNP:4987867
complement(6021)-g, adbSNP:56041624
complement(6082..6083)-, adbSNP:34143126
complement(6140)-t, cdbSNP:148888145
complement(6262)-c, adbSNP:4987868
complement(6285)-g, cdbSNP:182433677
complement(6326)-t, cdbSNP:45503395
6341+a, cdbSNP:4987869
complement(6341)-t, gdbSNP:386597121
complement(6383..6384)-, adbSNP:79620975
complement(6383..6384)-, adbSNP:386597122
6384+, tdbSNP:4987870
Gene SymbolBCL2
Gene SynonymBcl-2; PPP1R50
Chromosome18
Locus Map18q21.3
Title Pan-Bcl-2 inhibitor, GX15-070 (obatoclax), decreases human T regulatory lymphocytes while preserving effector T lymphocytes: a rationale for its use in combination immunotherapy .
Author Kim PS, Jochems C, Grenga I, Donahue RN, Tsang KY, Gulley JL, Schlom J and Farsaci B.
Journal J. Immunol. 192 (6), 2622-2633 (2014)
Title Structural basis for the conserved binding mechanism of MDM2-inhibiting peptides and anti-apoptotic Bcl-2 family proteins .
Author Lee MS, Ha JH, Yoon HS, Lee CK and Chi SW.
Journal Biochem. Biophys. Res. Commun. 445 (1), 120-125 (2014)
Title Feedback regulation mediated by Bcl-2 and DARPP-32 regulates inositol 1,4,5-trisphosphate receptor phosphorylation and promotes cell survival .
Author Chang MJ, Zhong F, Lavik AR, Parys JB, Berridge MJ and Distelhorst CW.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (3), 1186-1191 (2014)
Title [Fas, FasL, and bcl-2 expression on hepatic intralobar lymphocytes in different variants of the natural course of chronic HBV and HCV infection and in its outcomes] .
Author Karev,V.E.
Journal Arkh. Patol. 76 (1), 16-21 (2014)
Title Mutational analysis of Bax and Bcl-2 in childhood acute lymphoblastic leukaemia .
Author Salomons GS, Buitenhuis CK, Martinez Munoz C, Verwijs-Jassen M, Behrendt H, Zsiros J and Smets LA.
Journal Int. J. Cancer 79 (3), 273-277 (1998)
Title A cis-acting element in the BCL-2 gene controls expression through translational mechanisms .
Author Harigai M, Miyashita T, Hanada M and Reed JC.
Journal Oncogene 12 (6), 1369-1374 (1996)
Title Ultrastructural localization of bcl-2 protein .
Author Monaghan P, Robertson D, Amos TA, Dyer MJ, Mason DY and Greaves MF.
Journal J. Histochem. Cytochem. 40 (12), 1819-1825 (1992)
Title Bcl-2 confers growth and survival advantage to interleukin 7-dependent early pre-B cells which become factor independent by a multistep process in culture .
Author Borzillo GV, Endo K and Tsujimoto Y.
Journal Oncogene 7 (5), 869-876 (1992)
Title Frequent incidence of somatic mutations in translocated BCL2 oncogenes of non-Hodgkin's lymphomas .
Author Tanaka S, Louie DC, Kant JA and Reed JC.
Journal Blood 79 (1), 229-237 (1992)
Title [Isolation of a strain of Streptococcus pneumoniae multiresistant to antibiotics] .
Author Dublanchet,A. and Durieux,R.
Journal Nouv Presse Med 8 (11), 872 (1979)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.