• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha, mRNA.


RefSeq Accession Definition Services Price Order
NM_000633 Homo sapiens B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha, mRNA. ORF Sequence $208.80
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000633.2, 72198188
Length 6492 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha, mRNA.
Product apoptosis regulator Bcl-2 alpha isoform
Comment

Summary: This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (alpha) represents the longer transcript and encodes the longer isoform (alpha).

RefSeq NP_000624.2
CDS 494..1213
Misc Feature(1)392..394
Misc Feature(2)494..1210
Misc Feature(3)494..1210
Misc Feature(4)512..583
Misc Feature(5)521..583
Misc Feature(6)563..565
Misc Feature(7)593..598
Misc Feature(8)593..595
Misc Feature(9)659..661
Misc Feature(10)698..700
Misc Feature(11)698..700
Misc Feature(12)701..703
Misc Feature(13)701..703
Misc Feature(14)701..703
Misc Feature(15)713..715
Misc Feature(16)752..754
Misc Feature(17)752..754
Misc Feature(18)752..754
Misc Feature(19)770..814
Misc Feature(20)<773..1096
Misc Feature(21)782..808
Misc Feature(22)order(791..796,800..805,815..817,824..829,875..880,
Misc Feature(23)899..958
Misc Feature(24)order(899..907,917..955)
Misc Feature(25)1052..1099
Misc Feature(26)1052..1096
Misc Feature(27)1127..1192
Exon (1)1..207
Gene:BCL2
Gene Synonym:Bcl-2; PPP1R50
Exon (2)208..1078
Gene:BCL2
Gene Synonym:Bcl-2; PPP1R50
Exon (3)1079..6492
Gene:BCL2
Gene Synonym:Bcl-2; PPP1R50
Translation MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(18..19)-dbSNP:
complement(18..19)-, tdbSNP:34360708
complement(65)-g, cdbSNP:1473418
complement(71)-g, cdbSNP:192114822
complement(123)-c, adbSNP:34223591
complement(361)-g, adbSNP:55805819
complement(452)-g, adbSNP:114373512
complement(493)-t, cdbSNP:193014588
complement(514)-g, adbSNP:1801018
complement(620)-g, adbSNP:1800477
complement(640)-g, adbSNP:200972039
complement(738)-g, adbSNP:201827119
complement(793)-g, adbSNP:61733416
complement(863)-g, adbSNP:61733415
complement(952)-g, adbSNP:137945099
complement(990)-g, adbSNP:201085318
complement(1094)-g, adbSNP:143441810
complement(1100)-t, cdbSNP:148811059
complement(1157)-t, cdbSNP:113163226
complement(1202)-t, cdbSNP:138465313
complement(1235)-t, gdbSNP:200716283
complement(1363)-t, gdbSNP:190262124
complement(1372..1373)-, gtdbSNP:34883036
complement(1373..1374)-, tgdbSNP:140093696
complement(1471)-t, adbSNP:4987842
complement(1530)-g, adbSNP:4987843
complement(1537)-t, adbSNP:185016407
complement(1578)-c, adbSNP:116616724
complement(1734)-t, gdbSNP:113379949
complement(1753)-c, adbSNP:41301945
complement(1798)-c, adbSNP:4987844
complement(1841)-t, cdbSNP:191858049
complement(1880)-t, cdbSNP:3744937
complement(1883)-g, adbSNP:4987845
complement(1890)-t, cdbSNP:3744936
complement(1893)-g, adbSNP:4987846
complement(1943)-t, cdbSNP:150966214
complement(1997)-g, adbSNP:1016860
complement(2050)-g, adbSNP:4987847
complement(2108)-t, cdbSNP:141174596
complement(2118)-t, cdbSNP:116117134
complement(2155)-g, adbSNP:4987848
complement(2278)-t, cdbSNP:2078303
complement(2302)-t, cdbSNP:144527240
complement(2391)-t, cdbSNP:3744935
complement(2399)-t, gdbSNP:4987849
complement(2417)-g, adbSNP:1564483
complement(2505)-g, adbSNP:145009492
complement(2526)-g, adbSNP:187455180
complement(2555)-g, adbSNP:4987850
complement(2568)-t, gdbSNP:149940394
complement(2592)-t, cdbSNP:139755068
complement(2658)-g, adbSNP:1050618
complement(2678)-t, cdbSNP:150653783
complement(2747..2748)-, tdbSNP:202112192
complement(2784)-g, adbSNP:181495000
complement(2794)-t, adbSNP:180847268
complement(2795)-t, adbSNP:113207678
complement(2803)-, tdbSNP:5825508
complement(2812)-g, adbSNP:4987851
complement(3142)-t, cdbSNP:184698169
complement(3150)-g, adbSNP:4987852
complement(3249)-g, adbSNP:181211289
complement(3319)-g, adbSNP:142756703
complement(3320)-t, cdbSNP:139528731
complement(3375)-t, cdbSNP:188797102
complement(3416)-g, adbSNP:4987853
complement(3445)-g, adbSNP:4987854
complement(3522)-g, adbSNP:4987855
complement(3550)-t, cdbSNP:117640948
complement(3577)-g, adbSNP:4987856
complement(3624)-g, adbSNP:146379399
complement(3627)-t, cdbSNP:4987857
complement(3654)-t, gdbSNP:142265965
complement(3741)-t, cdbSNP:148341476
complement(3840)-g, adbSNP:17070680
complement(4097)-g, adbSNP:183691931
complement(4277)-t, cdbSNP:4987858
complement(4393)-g, adbSNP:137980414
complement(4396)-g, adbSNP:41306972
complement(4414)-g, adbSNP:4987859
complement(4484)-g, adbSNP:4987860
complement(4507)-t, cdbSNP:4987861
complement(4519)-g, adbSNP:188618198
complement(4594)-t, gdbSNP:146967889
complement(4724)-g, adbSNP:141080340
complement(4725)-c, adbSNP:147777348
complement(4764)-g, adbSNP:4987862
complement(4771)-g, adbSNP:185704013
complement(4790)-g, adbSNP:193151005
complement(4850)-g, adbSNP:200305018
complement(4897)-t, adbSNP:146086350
complement(4926..4927)-, cdbSNP:142611734
complement(4988)-t, cdbSNP:187334313
complement(4994)-t, gdbSNP:4987863
complement(5118)-g, adbSNP:183000521
complement(5163)-g, adbSNP:140875276
complement(5175)-t, cdbSNP:45520140
complement(5183)-t, cdbSNP:77530335
complement(5184)-t, adbSNP:76721111
complement(5193..5194)-, adbSNP:67200314
complement(5194..5195)-, adbSNP:34811186
complement(5194)-t, adbSNP:113158648
complement(5195)-t, adbSNP:77938688
complement(5337)-t, gdbSNP:4987864
complement(5514)-g, adbSNP:4987865
complement(5567)-t, adbSNP:190011740
complement(5607)-, adbSNP:45489598
complement(5745)-t, adbSNP:45468492
complement(5750)-g, adbSNP:4987866
complement(5856)-g, adbSNP:187081713
complement(5905)-t, cdbSNP:142616439
complement(5999)-g, adbSNP:4987867
complement(6021)-g, adbSNP:56041624
complement(6082..6083)-, adbSNP:34143126
complement(6140)-t, cdbSNP:148888145
complement(6262)-c, adbSNP:4987868
complement(6285)-g, cdbSNP:182433677
complement(6326)-t, cdbSNP:45503395
complement(6341)-c, adbSNP:4987869
complement(6383..6384)-, adbSNP:79620975
complement(6384)-, tdbSNP:4987870
Gene SymbolBCL2
Gene SynonymBcl-2; PPP1R50
Chromosome18
Locus Map18q21.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000633 Homo sapiens B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha, mRNA. Full Length $2921.40
ORF Sequence $208.80
NM_000657 Homo sapiens B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant beta, mRNA. Full Length $350.03
ORF Sequence $179.22
Title Both CpG methylation and activation-induced deaminase are required for the fragility of the human bcl-2 major breakpoint region: implications for the timing of the breaks in the t(14;18) translocation .
Author Cui,X., Lu,Z., Kurosawa,A., Klemm,L., Bagshaw,A.T., Tsai,A.G., Gemmell,N., Muschen,M., Adachi,N., Hsieh,C.L. and Lieber,M.R.
Journal Mol. Cell. Biol. 33 (5), 947-957 (2013)
Title Localization of the NRAS:BCL-2 complex determines anti-apoptotic features associated with progressive disease in myelodysplastic syndromes .
Author Le Pogam,C., Krief,P., Beurlet,S., Soulie,A., Balitrand,N., Cassinat,B., Cave,H., Kosmider,O., Setterblad,N., Leboeuf,C., Sarda-Mantel,L., Hervatin,F., Merlet,P., Noguera,M.E., Janin,A., Pla,M., Fontenay,M., Ades,L., Fenaux,P., Chomienne,C., Padua,R.A. and Omidvar,N.
Journal Leuk. Res. 37 (3), 312-319 (2013)
Title Dual inhibition of Bcl-2 and Bcl-xL strikingly enhances PI3K inhibition-induced apoptosis in human myeloid leukemia cells through a GSK3- and Bim-dependent mechanism .
Author Rahmani,M., Aust,M.M., Attkisson,E., Williams,D.C. Jr., Ferreira-Gonzalez,A. and Grant,S.
Journal Cancer Res. 73 (4), 1340-1351 (2013)
Title Is the immunohistochemical expression of proliferation (Ki-67) and apoptosis (Bcl-2) markers and cyclooxigenase-2 (COX-2) related to carcinogenesis in postmenopausal endometrial polyps? .
Author Antunes,A. Jr., Andrade,L.A., Pinto,G.A., Leao,R., Pinto-Neto,A.M. and Costa-Paiva,L.
Journal Anal. Quant. Cytol. Histol. 34 (5), 264-272 (2012)
Title Expression and mutation analyses of Fas, FLIP and Bcl-2 in granulosa cell tumor of ovary .
Author Yoo,N.J., Kim,M.S. and Lee,S.H.
Journal Tumori 98 (5), 118E-121E (2012)
Title Ultrastructural localization of bcl-2 protein .
Author Monaghan,P., Robertson,D., Amos,T.A., Dyer,M.J., Mason,D.Y. and Greaves,M.F.
Journal J. Histochem. Cytochem. 40 (12), 1819-1825 (1992)
Title Overexpressed full-length human BCL2 extends the survival of baculovirus-infected Sf9 insect cells .
Author Alnemri,E.S., Robertson,N.M., Fernandes,T.F., Croce,C.M. and Litwack,G.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (16), 7295-7299 (1992)
Title Bcl-2 confers growth and survival advantage to interleukin 7-dependent early pre-B cells which become factor independent by a multistep process in culture .
Author Borzillo,G.V., Endo,K. and Tsujimoto,Y.
Journal Oncogene 7 (5), 869-876 (1992)
Title Frequent incidence of somatic mutations in translocated BCL2 oncogenes of non-Hodgkin's lymphomas .
Author Tanaka,S., Louie,D.C., Kant,J.A. and Reed,J.C.
Journal Blood 79 (1), 229-237 (1992)
Title [Isolation of a strain of Streptococcus pneumoniae multiresistant to antibiotics] .
Author Dublanchet,A. and Durieux,R.
Journal Nouv Presse Med 8 (11), 872 (1979)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878