• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transforming growth factor, beta 1 (TGFB1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000660 Homo sapiens transforming growth factor, beta 1 (TGFB1), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_000660.4, 260655621
Length 2217 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens transforming growth factor, beta 1 (TGFB1), mRNA.
Product transforming growth factor beta-1 precursor
Comment

Summary: This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types. Many cells have TGFB receptors, and the protein positively and negatively regulates many other growth factors. The secreted protein is cleaved into a latency-associated peptide (LAP) and a mature TGFB1 peptide, and is found in either a latent form composed of a TGFB1 homodimer, a LAP homodimer, and a latent TGFB1-binding protein, or in an active form composed of a TGFB1 homodimer. The mature peptide may also form heterodimers with other TGFB family members. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease.[provided by RefSeq, Oct 2009].

RefSeq NP_000651.3
CDS 883..2055
Misc Feature(1)44
Misc Feature(2)127..129
Misc Feature(3)314
Misc Feature(4)964..1665
Misc Feature(5)964..1665
Misc Feature(6)970..1104
Misc Feature(7)1105..1695
Misc Feature(8)1612..1620
Misc Feature(9)1750..2052
Exon (1)1..1237
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Exon (2)1238..1398
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Exon (3)1399..1516
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Exon (4)1517..1594
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Exon (5)1595..1742
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Exon (6)1743..1896
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Exon (7)1897..2200
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Translation MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(26)-dbSNP:
complement(26)-t, gdbSNP:12977628
complement(50)-g, adbSNP:12977601
complement(51)-t, adbSNP:12985978
complement(56)-g, cdbSNP:11466315
complement(105)-g, adbSNP:36185305
complement(120..121)-, cdbSNP:1800999
complement(121..122)-, cdbSNP:1799753
complement(138)-g, adbSNP:200356936
complement(201)-g, adbSNP:202216587
complement(235)-g, cdbSNP:11551223
complement(241)-t, cdbSNP:79132525
complement(242)-t, cdbSNP:78191244
complement(256)-c, adbSNP:201584846
complement(303)-t, adbSNP:200340671
complement(320)-g, cdbSNP:202039131
complement(327)-g, cdbSNP:200883456
complement(335)-t, cdbSNP:200117700
complement(341)-g, adbSNP:201677979
complement(413)-c, adbSNP:35025994
complement(428)-g, adbSNP:200773845
complement(429)-g, adbSNP:199974871
complement(430)-t, cdbSNP:11551226
complement(439)-t, adbSNP:202033907
complement(464)-g, adbSNP:200915629
complement(496)-t, cdbSNP:11466316
complement(523)-g, adbSNP:201696222
complement(540)-t, gdbSNP:200716568
complement(555)-g, adbSNP:45457101
complement(559)-g, cdbSNP:201530894
complement(571)-t, gdbSNP:200538848
complement(607)-c, adbSNP:13306706
complement(608)-g, cdbSNP:201704451
complement(623)-t, gdbSNP:147066206
complement(625)-t, cdbSNP:200500159
complement(634)-c, adbSNP:13306707
complement(635)-g, adbSNP:141633455
complement(647)-g, cdbSNP:45616242
complement(654)-g, cdbSNP:61761350
complement(670)-g, adbSNP:201093139
712+, cdbSNP:281865481
complement(727)-g, adbSNP:200273952
complement(741)-t, cdbSNP:13306708
complement(759)-t, gdbSNP:201020311
complement(764..765)-, gggdbSNP:200016578
complement(769)-g, adbSNP:36102838
complement(792)-g, cdbSNP:199968369
complement(807)-g, adbSNP:201994282
complement(810)-t, cdbSNP:56155294
complement(817)-g, adbSNP:149770409
complement(838)-t, g, cdbSNP:140027851
complement(847)-t, cdbSNP:200135233
complement(849)-c, adbSNP:151118561
complement(855)-g, cdbSNP:201619377
complement(869)-g, adbSNP:9282871
complement(872)-g, adbSNP:199947003
complement(894)-g, cdbSNP:201834171
complement(911..912)-, adbSNP:201844761
911+c, tdbSNP:1800470
920..921+, gctgctgctdbSNP:281865483
complement(937)-t, cdbSNP:72480425
complement(954)-t, gdbSNP:146353438
956+c, gdbSNP:1800471
complement(967)-t, cdbSNP:200868154
complement(968)-t, g, cdbSNP:199758510
complement(969)-g, c, adbSNP:66551611
complement(973)-t, gdbSNP:61761349
complement(978)-t, gdbSNP:139854151
complement(1022)-g, adbSNP:13447341
complement(1057)-t, gdbSNP:145953838
complement(1060)-g, cdbSNP:201283333
complement(1093)-t, cdbSNP:200230522
complement(1104)-g, adbSNP:149455461
complement(1122)-t, cdbSNP:199592796
1123+c, tdbSNP:111033611
complement(1134)-t, gdbSNP:199704558
complement(1138)-c, adbSNP:201155269
complement(1168)-t, cdbSNP:200512008
complement(1173)-g, adbSNP:147873920
complement(1182)-t, c, adbSNP:137864931
complement(1230)-g, adbSNP:56281462
complement(1254)-dbSNP:
complement(1254)-g, adbSNP:201417808
complement(1274)-g, adbSNP:200652346
complement(1277)-t, cdbSNP:200481365
complement(1278)-g, adbSNP:199696548
complement(1281)-t, cdbSNP:201567874
complement(1293)-t, adbSNP:202071274
complement(1323)-g, cdbSNP:200674778
complement(1324)-t, cdbSNP:142642007
complement(1336)-g, adbSNP:201405597
complement(1348)-g, adbSNP:200482214
1387+a, gdbSNP:281865484
complement(1392)-t, cdbSNP:199678149
complement(1411)-dbSNP:
complement(1411)-t, cdbSNP:202057576
complement(1421)-t, cdbSNP:201951718
complement(1435)-g, adbSNP:201055697
complement(1436)-t, cdbSNP:200030349
complement(1438)-g, adbSNP:140746279
complement(1447)-g, adbSNP:201828175
complement(1453)-t, cdbSNP:201383660
complement(1486)-t, cdbSNP:151105395
complement(1489)-t, cdbSNP:142931834
complement(1495)-g, adbSNP:199882566
complement(1505)-c, adbSNP:146875339
complement(1511)-t, cdbSNP:201430293
complement(1516)-t, cdbSNP:200611791
complement(1531)-dbSNP:
complement(1531)-g, adbSNP:141352462
1534+c, tdbSNP:104894721
1535+a, gdbSNP:104894720
complement(1543)-t, cdbSNP:201327622
1546+c, gdbSNP:281865485
complement(1548)-g, adbSNP:200351572
1549+a, c, g, tdbSNP:104894722
1555+c, tdbSNP:104894719
complement(1558)-t, cdbSNP:202088345
complement(1562)-t, cdbSNP:201772874
complement(1576)-g, adbSNP:200317548
complement(1584)-t, cdbSNP:202184772
complement(1600)-dbSNP:
complement(1600)-t, gdbSNP:148552731
complement(1604)-t, cdbSNP:72480424
complement(1605)-t, g, adbSNP:35383147
complement(1613..1614)-, adbSNP:34233206
complement(1646)-t, cdbSNP:149900977
1670+c, tdbSNP:1800472
complement(1673)-g, adbSNP:146182311
complement(1674)-t, cdbSNP:200558128
complement(1690)-g, adbSNP:201948484
complement(1701)-g, adbSNP:141484614
complement(1713)-g, cdbSNP:201119217
complement(1755)-dbSNP:
complement(1755)-t, cdbSNP:190566789
complement(1769)-t, cdbSNP:200164212
complement(1774)-g, adbSNP:139977837
complement(1781)-g, adbSNP:201635147
complement(1789)-g, adbSNP:200527282
complement(1798)-g, adbSNP:199946261
complement(1800)-t, cdbSNP:72480429
complement(1821)-c, adbSNP:200763912
complement(1826)-t, cdbSNP:199516461
complement(1839)-g, cdbSNP:201366321
complement(1845)-g, adbSNP:11551225
complement(1854)-g, adbSNP:11466358
complement(1855)-g, cdbSNP:200209614
complement(1861)-t, gdbSNP:56361919
complement(1874)-t, cdbSNP:199713772
complement(1875)-g, adbSNP:201281623
complement(1879)-t, cdbSNP:200230083
complement(1892)-g, cdbSNP:199699574
complement(1952)-c, adbSNP:199849225
complement(2036)-t, cdbSNP:201700967
complement(2148)-g, adbSNP:201096069
complement(2153)-t, gdbSNP:200179008
complement(2161)-g, cdbSNP:201889805
complement(2184)-t, cdbSNP:200729745
complement(2191)-t, cdbSNP:199636275
complement(2192)-c, adbSNP:201564160
Gene SymbolTGFB1
Gene SynonymCED; DPD1; LAP; TGFB; TGFbeta
Chromosome19
Locus Map19q13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000660 Homo sapiens transforming growth factor, beta 1 (TGFB1), mRNA. On-demand TBD TBD
Title BMP and TGF-beta pathway mediators are critical upstream regulators of Wnt signaling during midbrain dopamine differentiation in human pluripotent stem cells .
Author Cai,J., Schleidt,S., Pelta-Heller,J., Hutchings,D., Cannarsa,G. and Iacovitti,L.
Journal Dev. Biol. 376 (1), 62-73 (2013)
Title Screening of circulating TGF-beta levels and its clinicopathological significance in human breast cancer .
Author Panis,C., Herrera,A.C., Victorino,V.J., Aranome,A.M. and Cecchini,R.
Journal Anticancer Res. 33 (2), 737-742 (2013)
Title Integrin control of the transforming growth factor-beta pathway in glioblastoma .
Author Roth,P., Silginer,M., Goodman,S.L., Hasenbach,K., Thies,S., Maurer,G., Schraml,P., Tabatabai,G., Moch,H., Tritschler,I. and Weller,M.
Journal Brain 136 (PT 2), 564-576 (2013)
Title tat protein stimulates production of transforming growth factor-beta 1 by marrow macrophages: a potential mechanism for human immunodeficiency virus-1-induced hematopoietic suppression .
Author Zauli,G., Davis,B.R., Re,M.C., Visani,G., Furlini,G. and La Placa,M.
Journal Blood 80 (12), 3036-3043 (1992)
Title TGF beta signals through a heteromeric protein kinase receptor complex .
Author Wrana,J.L., Attisano,L., Carcamo,J., Zentella,A., Doody,J., Laiho,M., Wang,X.F. and Massague,J.
Journal Cell 71 (6), 1003-1014 (1992)
Title Endoglin is a component of the transforming growth factor-beta receptor system in human endothelial cells .
Author Cheifetz,S., Bellon,T., Cales,C., Vera,S., Bernabeu,C., Massague,J. and Letarte,M.
Journal J. Biol. Chem. 267 (27), 19027-19030 (1992)
Title Characterization of the promoter region of the human transforming growth factor-beta 1 gene .
Author Kim,S.J., Glick,A., Sporn,M.B. and Roberts,A.B.
Journal J. Biol. Chem. 264 (1), 402-408 (1989)
Title Latent high molecular weight complex of transforming growth factor beta 1. Purification from human platelets and structural characterization .
Author Miyazono,K., Hellman,U., Wernstedt,C. and Heldin,C.H.
Journal J. Biol. Chem. 263 (13), 6407-6415 (1988)
Title Intron-exon structure of the human transforming growth factor-beta precursor gene .
Author Derynck,R., Rhee,L., Chen,E.Y. and Van Tilburg,A.
Journal Nucleic Acids Res. 15 (7), 3188-3189 (1987)
Title Human transforming growth factor-beta complementary DNA sequence and expression in normal and transformed cells .
Author Derynck,R., Jarrett,J.A., Chen,E.Y., Eaton,D.H., Bell,J.R., Assoian,R.K., Roberts,A.B., Sporn,M.B. and Goeddel,D.V.
Journal Nature 316 (6030), 701-705 (1985)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.