• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transforming growth factor, beta 1 (TGFB1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27680 Homo sapiens transforming growth factor, beta 1 (TGFB1), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu27680C Homo sapiens transforming growth factor, beta 1 (TGFB1), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000660.5, 551411950
Length 1173 bp
Structure linear
Update Date 26-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens transforming growth factor, beta 1 (TGFB1), mRNA.
Product transforming growth factor beta-1 precursor
Comment

Summary: This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types. Many cells have TGFB receptors, and the protein positively and negatively regulates many other growth factors. The secreted protein is cleaved into a latency-associated peptide (LAP) and a mature TGFB1 peptide, and is found in either a latent form composed of a TGFB1 homodimer, a LAP homodimer, and a latent TGFB1-binding protein, or in an active form composed of a TGFB1 homodimer. The mature peptide may also form heterodimers with other TGFB family members. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease.[provided by RefSeq, Oct 2009].

RefSeq NP_000651.3
CDS 890..2062
Misc Feature(1)51
Misc Feature(2)134..136
Misc Feature(3)321
Misc Feature(4)971..1672
Misc Feature(5)977..1111
Misc Feature(6)1112..1702
Misc Feature(7)1619..1627
Misc Feature(8)1757..2059
Exon (1)1..1244
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Exon (2)1245..1405
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Exon (3)1406..1523
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Exon (4)1524..1601
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Exon (5)1602..1749
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Exon (6)1750..1903
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Exon (7)1904..2583
Gene:TGFB1
Gene Synonym:CED; DPD1; LAP; TGFB; TGFbeta
Translation MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(33)-dbSNP:
complement(33)-t, gdbSNP:12977628
complement(57)-g, adbSNP:12977601
complement(58)-t, adbSNP:12985978
63+c, gdbSNP:11466315
112+a, gdbSNP:36185305
121..122+, cdbSNP:1800999
complement(128..129)-, cdbSNP:1799753
complement(145)-g, adbSNP:200356936
complement(208)-g, adbSNP:202216587
242+c, gdbSNP:11551223
complement(248)-t, cdbSNP:79132525
complement(249)-t, cdbSNP:78191244
complement(263)-c, adbSNP:201584846
complement(310)-t, adbSNP:200340671
complement(327)-g, cdbSNP:202039131
complement(334)-g, cdbSNP:200883456
complement(342)-t, cdbSNP:200117700
complement(348)-g, adbSNP:201677979
420+a, cdbSNP:35025994
complement(435)-g, adbSNP:200773845
complement(436)-g, adbSNP:199974871
complement(437)-t, cdbSNP:11551226
complement(446)-t, adbSNP:202033907
complement(471)-g, adbSNP:200915629
503+c, tdbSNP:11466316
complement(530)-g, adbSNP:201696222
complement(547)-t, gdbSNP:200716568
complement(562)-g, adbSNP:45457101
complement(566)-g, cdbSNP:201530894
complement(578)-t, gdbSNP:200538848
complement(614)-c, adbSNP:13306706
complement(615)-g, cdbSNP:201704451
complement(630)-t, gdbSNP:147066206
complement(632)-t, cdbSNP:200500159
641+a, cdbSNP:13306707
complement(641)-t, gdbSNP:386528022
complement(642)-g, adbSNP:141633455
654+c, gdbSNP:45616242
661+c, gdbSNP:61761350
complement(677)-g, adbSNP:201093139
719+, cdbSNP:281865481
complement(722)-t, adbSNP:375306535
complement(734)-g, adbSNP:200273952
complement(748)-t, cdbSNP:13306708
complement(766)-t, gdbSNP:201020311
complement(771..772)-, gggdbSNP:200016578
complement(776)-g, adbSNP:36102838
complement(799)-g, cdbSNP:199968369
complement(814)-g, adbSNP:201994282
complement(817)-t, cdbSNP:56155294
complement(824)-g, adbSNP:149770409
complement(845)-t, g, cdbSNP:140027851
complement(854)-t, cdbSNP:200135233
complement(856)-c, adbSNP:151118561
complement(862)-g, cdbSNP:201619377
complement(876)-g, adbSNP:9282871
complement(879)-g, adbSNP:199947003
complement(901)-g, cdbSNP:201834171
complement(918..919)-, adbSNP:201844761
927..928+, gctgctgctdbSNP:281865483
944+c, tdbSNP:72480425
complement(961)-t, gdbSNP:146353438
complement(974)-t, cdbSNP:200868154
975..976+a, c, gdbSNP:66551611
complement(975)-t, g, cdbSNP:199758510
980+g, tdbSNP:61761349
complement(985)-t, gdbSNP:139854151
1029+a, gdbSNP:13447341
complement(1064)-t, gdbSNP:145953838
complement(1067)-g, cdbSNP:201283333
complement(1100)-t, cdbSNP:200230522
complement(1111)-g, adbSNP:149455461
complement(1129)-t, cdbSNP:199592796
1130+c, tdbSNP:111033611
complement(1141)-t, gdbSNP:199704558
complement(1145)-c, adbSNP:201155269
complement(1155)-g, adbSNP:371589941
complement(1175)-t, cdbSNP:200512008
complement(1180)-g, adbSNP:147873920
complement(1189)-t, c, adbSNP:137864931
complement(1237)-g, adbSNP:56281462
complement(1261)-dbSNP:
complement(1261)-g, adbSNP:201417808
complement(1281)-g, adbSNP:200652346
complement(1284)-t, cdbSNP:200481365
complement(1285)-g, adbSNP:199696548
complement(1288)-t, cdbSNP:201567874
complement(1300)-t, adbSNP:202071274
complement(1330)-g, cdbSNP:200674778
complement(1331)-t, cdbSNP:142642007
complement(1341)-g, adbSNP:374698583
complement(1343)-g, adbSNP:201405597
complement(1355)-g, adbSNP:200482214
1394+a, gdbSNP:281865484
complement(1399)-t, cdbSNP:199678149
complement(1418)-dbSNP:
complement(1418)-t, cdbSNP:202057576
complement(1428)-t, cdbSNP:201951718
complement(1442)-g, adbSNP:201055697
complement(1443)-t, cdbSNP:200030349
complement(1445)-g, adbSNP:140746279
complement(1454)-g, adbSNP:201828175
complement(1460)-t, cdbSNP:201383660
complement(1493)-t, cdbSNP:151105395
complement(1496)-t, cdbSNP:142931834
complement(1502)-g, adbSNP:199882566
complement(1512)-c, adbSNP:146875339
complement(1518)-t, cdbSNP:201430293
complement(1523)-t, cdbSNP:200611791
complement(1531)-dbSNP:
complement(1531)-t, adbSNP:373381454
complement(1538)-g, adbSNP:141352462
1541+c, tdbSNP:104894721
1542+a, gdbSNP:104894720
complement(1550)-t, cdbSNP:201327622
1553+c, gdbSNP:281865485
complement(1555)-g, adbSNP:200351572
1556+a, c, g, tdbSNP:104894722
1562+c, tdbSNP:104894719
complement(1565)-t, cdbSNP:202088345
complement(1569)-t, cdbSNP:201772874
complement(1583)-g, adbSNP:200317548
complement(1591)-t, cdbSNP:202184772
complement(1607)-dbSNP:
complement(1607)-t, gdbSNP:148552731
1611+c, tdbSNP:72480424
complement(1612)-t, g, adbSNP:35383147
complement(1620..1621)-, adbSNP:34233206
complement(1653)-t, cdbSNP:149900977
1677+c, tdbSNP:1800472
complement(1680)-g, adbSNP:146182311
complement(1681)-t, cdbSNP:200558128
complement(1687)-t, cdbSNP:267605501
complement(1690)-t, cdbSNP:373586759
complement(1697)-g, adbSNP:201948484
complement(1708)-g, adbSNP:141484614
complement(1720)-g, cdbSNP:201119217
complement(1762)-dbSNP:
complement(1762)-t, cdbSNP:190566789
complement(1776)-t, cdbSNP:200164212
complement(1781)-g, adbSNP:139977837
complement(1788)-g, adbSNP:201635147
complement(1796)-g, adbSNP:200527282
complement(1805)-g, adbSNP:199946261
complement(1807)-t, cdbSNP:72480429
complement(1815)-t, cdbSNP:369182751
complement(1828)-c, adbSNP:200763912
complement(1833)-t, cdbSNP:199516461
complement(1846)-g, cdbSNP:201366321
complement(1852)-g, adbSNP:11551225
complement(1861)-g, adbSNP:11466358
complement(1862)-g, cdbSNP:200209614
complement(1868)-t, gdbSNP:56361919
complement(1881)-t, cdbSNP:199713772
complement(1882)-g, adbSNP:201281623
complement(1886)-t, cdbSNP:200230083
complement(1899)-g, cdbSNP:199699574
complement(1936)-t, gdbSNP:368054278
complement(1951)-t, cdbSNP:373910726
complement(1959)-c, adbSNP:199849225
complement(1993)-g, adbSNP:370517732
complement(2043)-t, cdbSNP:201700967
complement(2155)-g, adbSNP:201096069
complement(2160)-t, gdbSNP:200179008
complement(2168)-g, cdbSNP:201889805
complement(2191)-t, cdbSNP:200729745
complement(2198)-t, cdbSNP:199636275
complement(2199)-c, adbSNP:201564160
complement(2234)-g, cdbSNP:200673279
complement(2242)-t, cdbSNP:199517779
complement(2258)-g, c, adbSNP:201103297
complement(2264)-g, cdbSNP:200451143
complement(2276)-g, adbSNP:199704340
complement(2278)-g, adbSNP:201584524
complement(2284)-g, cdbSNP:200340652
complement(2302)-t, gdbSNP:202014722
complement(2321)-t, cdbSNP:201075248
complement(2327)-t, cdbSNP:145297814
complement(2357)-g, adbSNP:201969193
complement(2389)-g, adbSNP:201098768
complement(2394)-g, adbSNP:199972613
complement(2407)-g, adbSNP:202033577
Gene SymbolTGFB1
Gene SynonymCED; DPD1; LAP; TGFB; TGFbeta
Chromosome19
Locus Map19q13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000660 Homo sapiens transforming growth factor, beta 1 (TGFB1), mRNA. On-demand TBD TBD
Title [Role of transforming growth factor-beta in the development of some liver diseases] .
Author Raikhelson,K.L., Karev,V.E., Marchenko,N.V., Semenov,N.V., Palgova,L.K. and Baranovsky,A.Y.
Journal Ter. Arkh. 86 (2), 44-48 (2014)
Title Release of leukotriene B4, transforming growth factor-beta1 and microparticles in relation to aortic valve calcification .
Author Kochtebane N, Passefort S, Choqueux C, Ainoun F, Achour L, Michel JB, Back M and Jacob MP.
Journal J. Heart Valve Dis. 22 (6), 782-788 (2013)
Title The expression of glutathione peroxidase-1 and the anabolism of collagen regulation pathway transforming growth factor-beta1-connective tissue growth factor in women with uterine prolapse and the clinic significance .
Author Li BS, Hong L, Min J, Wu DB, Hu M and Guo WJ.
Journal Clin Exp Obstet Gynecol 40 (4), 586-590 (2013)
Title Camurati-Engelmann Disease .
Author Wallace,S.E. and Wilcox,W.R.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title tat protein stimulates production of transforming growth factor-beta 1 by marrow macrophages: a potential mechanism for human immunodeficiency virus-1-induced hematopoietic suppression .
Author Zauli G, Davis BR, Re MC, Visani G, Furlini G and La Placa M.
Journal Blood 80 (12), 3036-3043 (1992)
Title Endoglin is a component of the transforming growth factor-beta receptor system in human endothelial cells .
Author Cheifetz S, Bellon T, Cales C, Vera S, Bernabeu C, Massague J and Letarte M.
Journal J. Biol. Chem. 267 (27), 19027-19030 (1992)
Title Characterization of the promoter region of the human transforming growth factor-beta 1 gene .
Author Kim SJ, Glick A, Sporn MB and Roberts AB.
Journal J. Biol. Chem. 264 (1), 402-408 (1989)
Title Latent high molecular weight complex of transforming growth factor beta 1. Purification from human platelets and structural characterization .
Author Miyazono K, Hellman U, Wernstedt C and Heldin CH.
Journal J. Biol. Chem. 263 (13), 6407-6415 (1988)
Title Intron-exon structure of the human transforming growth factor-beta precursor gene .
Author Derynck,R., Rhee,L., Chen,E.Y. and Van Tilburg,A.
Journal Nucleic Acids Res. 15 (7), 3188-3189 (1987)
Title Human transforming growth factor-beta complementary DNA sequence and expression in normal and transformed cells .
Author Derynck,R., Jarrett,J.A., Chen,E.Y., Eaton,D.H., Bell,J.R., Assoian,R.K., Roberts,A.B., Sporn,M.B. and Goeddel,D.V.
Journal Nature 316 (6030), 701-705 (1985)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.