• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA.


RefSeq Accession Definition Services Price Order
NM_000662 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. ORF Sequence $253.17
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000662.5, 237649115
Length 1815 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA.
Product arylamine N-acetyltransferase 1 isoform a
Comment

Summary: This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (5) lacks two alternate exons in the 5' UTR, compared to variant 1, and is the predominant transcript. This variant is transcribed from a promoter 11.8 kb upstream of the coding exon known as the P1, promoter 2, or NATb promoter. Variants 1-6 and 9 all encode the same isoform (a).

RefSeq NP_000653.3
CDS 158..1030
Misc Feature(1)71..73
Misc Feature(2)215..997
Misc Feature(3)215..997
Misc Feature(4)359..361
Misc Feature(5)473..478
Exon (1)1..72
Gene:NAT1
Gene Synonym:AAC1; MNAT; NAT-1; NATI
Exon (2)73..151
Gene:NAT1
Gene Synonym:AAC1; MNAT; NAT-1; NATI
Exon (3)152..1799
Gene:NAT1
Gene Synonym:AAC1; MNAT; NAT-1; NATI
Translation MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVV RRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYI VDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDL LEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLT HRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
58+dbSNP:
58+a, gdbSNP:74515534
97+dbSNP:
97+a, gdbSNP:186784764
178+g, tdbSNP:4986992
226+a, gdbSNP:149335741
232+c, tdbSNP:201603160
254+c, tdbSNP:56318881
255+a, gdbSNP:111848753
290+g, tdbSNP:181298696
347+c, tdbSNP:56379106
348+a, gdbSNP:138061602
358+c, gdbSNP:200617057
446+c, gdbSNP:142535782
498+c, tdbSNP:145975713
507..508+cc, ggdbSNP:72554606
507+c, gdbSNP:55641436
508+c, gdbSNP:72554607
520+c, tdbSNP:8190858
537+a, gdbSNP:200857632
559+c, tdbSNP:146727732
602+a, gdbSNP:4987076
616+a, gdbSNP:4986990
625+c, tdbSNP:141809132
654..656+ccc, gggdbSNP:72554608
654+c, gdbSNP:56328478
661+g, tdbSNP:139028182
716+c, tdbSNP:5030839
717+a, gdbSNP:4986782
729+c, tdbSNP:141552883
753+c, tdbSNP:144790969
770+a, gdbSNP:72554609
777+c, tdbSNP:4987195
797+g, tdbSNP:4986783
848+g, tdbSNP:201916736
872+c, tdbSNP:201435802
894+a, gdbSNP:201129487
909+a, tdbSNP:56172717
913+a, tdbSNP:112846752
934+c, g, tdbSNP:4986991
938+a, gdbSNP:72554610
944+a, gdbSNP:72554611
964+c, tdbSNP:201670530
997+a, gdbSNP:140926150
1041+a, g, tdbSNP:55793712
1088+c, tdbSNP:4986994
1095+a, tdbSNP:185560923
1106+c, gdbSNP:148795488
1113+c, gdbSNP:112473771
1130+, adbSNP:72554612
1171+a, tdbSNP:11985819
1181+, tdbSNP:8190859
1216+a, tdbSNP:3197750
1219+c, tdbSNP:201385757
1221..1223+, aaadbSNP:4646271
1228+a, gdbSNP:189975159
1244..1245+, taadbSNP:201620783
1245+a, tdbSNP:1057126
1247..1248+a, tdbSNP:8190861
1252+a, cdbSNP:15561
1262+, tdbSNP:72554613
1348+g, tdbSNP:4986993
1355+c, tdbSNP:182238333
1393+a, gdbSNP:4987077
1434+a, gdbSNP:28359534
1502+c, gdbSNP:8190862
1524+a, gdbSNP:6982949
1533+c, gdbSNP:187694475
1534+c, tdbSNP:8190863
1611+c, tdbSNP:8190864
1730+a, gdbSNP:1907951
1771+, gdbSNP:199835690
1772+, tdbSNP:200909130
1798+a, cdbSNP:76801676
1799+, adbSNP:68160149
1799+a, cdbSNP:8190865
Gene SymbolNAT1
Gene SynonymAAC1; MNAT; NAT-1; NATI
Chromosome8
Locus Map8p22
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000662 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. Full Length $526.35
ORF Sequence $253.17
NM_001160170 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 1, mRNA. Full Length $681.21
ORF Sequence $253.17
NM_001160171 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 2, mRNA. Full Length $637.71
ORF Sequence $253.17
NM_001160172 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 3, mRNA. Full Length $614.80
ORF Sequence $253.17
NM_001160173 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 4, mRNA. Full Length $569.85
ORF Sequence $253.17
NM_001160174 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 6, mRNA. Full Length $591.02
ORF Sequence $253.17
NM_001160175 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 7, mRNA. Full Length $604.07
ORF Sequence $307.11
NM_001160176 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 8, mRNA. Full Length $560.57
ORF Sequence $307.11
NM_001160179 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 9, mRNA. Full Length $587.25
ORF Sequence $253.17
Title N-acetyltransferase polymorphism and risk of colorectal adenoma and cancer: a pooled analysis of variations from 59 studies .
Author Liu,J., Ding,D., Wang,X., Chen,Y., Li,R., Zhang,Y. and Luo,R.
Journal PLoS ONE 7 (8), E42797 (2012)
Title Variable NAT1 enzyme activity in long-term cultured human HaCaT keratinocytes .
Author Scheitza,S., Bonifas,J. and Blomeke,B.
Journal J. Toxicol. Environ. Health Part A 75 (8-10), 471-477 (2012)
Title Arylamine N-acetyltransferase I .
Author Minchin,R.F., Hanna,P.E., Dupret,J.M., Wagner,C.R., Rodrigues-Lima,F. and Butcher,N.J.
Journal Int. J. Biochem. Cell Biol. 39 (11), 1999-2005 (2007)
Title Functional properties of an alternative, tissue-specific promoter for human arylamine N-acetyltransferase 1 .
Author Barker,D.F., Husain,A., Neale,J.R., Martini,B.D., Zhang,X., Doll,M.A., States,J.C. and Hein,D.W.
Journal Pharmacogenet. Genomics 16 (7), 515-525 (2006)
Title Structural analysis of the genes for human arylamine N-acetyltransferases and characterisation of alternative transcripts .
Author Boukouvala,S. and Sim,E.
Journal Basic Clin. Pharmacol. Toxicol. 96 (5), 343-351 (2005)
Title Identification of the major promoter and non-coding exons of the human arylamine N-acetyltransferase 1 gene (NAT1) .
Author Husain,A., Barker,D.F., States,J.C., Doll,M.A. and Hein,D.W.
Journal Pharmacogenetics 14 (7), 397-406 (2004)
Title Identification of a minimal promoter sequence for the human N-acetyltransferase Type I gene that binds AP-1 (activator protein 1) and YY-1 (Yin and Yang 1) .
Author Butcher,N.J., Arulpragasam,A., Pope,C. and Minchin,R.F.
Journal Biochem. J. 376 (PT 2), 441-448 (2003)
Title Site-directed mutagenesis of recombinant human arylamine N-acetyltransferase expressed in Escherichia coli. Evidence for direct involvement of Cys68 in the catalytic mechanism of polymorphic human NAT2 .
Author Dupret,J.M. and Grant,D.M.
Journal J. Biol. Chem. 267 (11), 7381-7385 (1992)
Title Human arylamine N-acetyltransferase genes: isolation, chromosomal localization, and functional expression .
Author Blum,M., Grant,D.M., McBride,W., Heim,M. and Meyer,U.A.
Journal DNA Cell Biol. 9 (3), 193-203 (1990)
Title Cloning and expression of cDNAs for polymorphic and monomorphic arylamine N-acetyltransferases from human liver .
Author Ohsako,S. and Deguchi,T.
Journal J. Biol. Chem. 265 (8), 4630-4634 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878