• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu24502 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu24502C Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000662.7, 634743283
Length 873 bp
Structure linear
Update Date 14-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA.
Product arylamine N-acetyltransferase 1 isoform a
Comment

Summary: This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human genome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011].


Transcript Variant: This variant (5, also known as Type IIA) lacks two alternate exons in the 5' UTR, compared to variant 1, and is the predominant transcript. This variant is transcribed from a promoter known as P1, promoter 2, or NATb promoter. Variants 1-6 and 9 all encode the same isoform (a).

RefSeq NP_000653.3
CDS 164..1036
Misc Feature(1)77..79
Misc Feature(2)77..79
Misc Feature(3)164..166
Misc Feature(4)164..166
Misc Feature(5)221..1003
Misc Feature(6)365..367
Misc Feature(7)479..484
Exon (1)1..78
Gene:NAT1
Gene Synonym:AAC1; MNAT; NAT-1; NATI
Exon (2)79..157
Gene:NAT1
Gene Synonym:AAC1; MNAT; NAT-1; NATI
Exon (3)158..1805
Gene:NAT1
Gene Synonym:AAC1; MNAT; NAT-1; NATI
Translation MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVV RRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYI VDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDL LEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLT HRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolNAT1
Gene SynonymAAC1; MNAT; NAT-1; NATI
Chromosome8
Locus Map8p22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000662 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. In-stock $99.00 5-7
NM_000662 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. In-stock $99.00 5-7
NM_000662 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. In-stock $99.00 5-7
NM_000662 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. In-stock $99.00 5-7
NM_000662 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. In-stock $99.00 5-7
NM_000662 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. In-stock $99.00 5-7
NM_000662 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. In-stock $99.00 5-7
NM_000662 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. In-stock $99.00 5-7
NM_000662 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. In-stock $99.00 5-7
NM_000662 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. In-stock $99.00 5-7
NM_000662 Homo sapiens N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1), transcript variant 5, mRNA. In-stock $99.00 5-7
Title Crippling the essential GTPase Der causes dependence on ribosomal protein L9 .
Author Naganathan A and Moore SD.
Journal J. Bacteriol. 195 (16), 3682-3691 (2013)
Title Arylamine N-acetyltransferase I .
Author Minchin RF, Hanna PE, Dupret JM, Wagner CR, Rodrigues-Lima F and Butcher NJ.
Journal Int. J. Biochem. Cell Biol. 39 (11), 1999-2005 (2007)
Title Functional properties of an alternative, tissue-specific promoter for human arylamine N-acetyltransferase 1 .
Author Barker DF, Husain A, Neale JR, Martini BD, Zhang X, Doll MA, States
Journal Pharmacogenet. Genomics 16 (7), 515-525 (2006)
Title Structural analysis of the genes for human arylamine N-acetyltransferases and characterisation of alternative transcripts .
Author Boukouvala S and Sim E.
Journal Basic Clin. Pharmacol. Toxicol. 96 (5), 343-351 (2005)
Title Genomic organization of human arylamine N-acetyltransferase Type I reveals alternative promoters that generate different 5'-UTR splice variants with altered translational activities .
Author Butcher NJ, Arulpragasam A, Goh HL, Davey T and Minchin RF.
Journal Biochem. J. 387 (PT 1), 119-127 (2005)
Title Identification of the major promoter and non-coding exons of the human arylamine N-acetyltransferase 1 gene (NAT1) .
Author Husain A, Barker DF, States JC, Doll MA and Hein DW.
Journal Pharmacogenetics 14 (7), 397-406 (2004)
Title Identification of a minimal promoter sequence for the human N-acetyltransferase Type I gene that binds AP-1 (activator protein 1) and YY-1 (Yin and Yang 1) .
Author Butcher NJ, Arulpragasam A, Pope C and Minchin RF.
Journal Biochem. J. 376 (PT 2), 441-448 (2003)
Title Site-directed mutagenesis of recombinant human arylamine N-acetyltransferase expressed in Escherichia coli. Evidence for direct involvement of Cys68 in the catalytic mechanism of polymorphic human NAT2 .
Author Dupret JM and Grant DM.
Journal J. Biol. Chem. 267 (11), 7381-7385 (1992)
Title Human arylamine N-acetyltransferase genes: isolation, chromosomal localization, and functional expression .
Author Blum M, Grant DM, McBride W, Heim M and Meyer UA.
Journal DNA Cell Biol. 9 (3), 193-203 (1990)
Title Cloning and expression of cDNAs for polymorphic and monomorphic arylamine N-acetyltransferases from human liver .
Author Ohsako S and Deguchi T.
Journal J. Biol. Chem. 265 (8), 4630-4634 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.