• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens adrenoceptor alpha 2A (ADRA2A), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000681 Homo sapiens adrenoceptor alpha 2A (ADRA2A), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_000681.3, 194353969
Length 3889 bp
Structure linear
Update Date 07-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens adrenoceptor alpha 2A (ADRA2A), mRNA.
Product alpha-2A adrenergic receptor
Comment

Summary: Alpha-2-adrenergic receptors are members of the G protein-coupled receptor superfamily. They include 3 highly homologous subtypes: alpha2A, alpha2B, and alpha2C. These receptors have a critical role in regulating neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system. Studies in mouse revealed that both the alpha2A and alpha2C subtypes were required for normal presynaptic control of transmitter release from sympathetic nerves in the heart and from central noradrenergic neurons; the alpha2A subtype inhibited transmitter release at high stimulation frequencies, whereas the alpha2C subtype modulated neurotransmission at lower levels of nerve activity. This gene encodes alpha2A subtype and it contains no introns in either its coding or untranslated sequences. [provided by RefSeq, Jul 2008].


Sequence Note: The 5'-most in-frame translation initiation codon is selected for this RefSeq based on good conservation across mammalian species. A possible downstream start codon would result in a protein that is 15 aa shorter at the N-terminus. The literature, including PMIDs:2823383, 2568356, 1354394 and 1678390, assumes the use of the downstream start codon based on initial cloning reports, but there is no experimental evidence indicating which start codon is preferentially used in vivo.

RefSeq NP_000672.3
CDS 966..2363
Misc Feature(1)861..863
Misc Feature(2)1011..1013
Misc Feature(3)1011..1013
Misc Feature(4)1134..>1520
Misc Feature(5)1176..>1694
Exon (1)1..3876
Gene:ADRA2A
Gene Synonym:ADRA2; ADRA2R; ADRAR; ALPHA2AAR; ZNF32
Translation MFRQEQPLAEGSFAPMGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLML LTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAW CEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVIS FPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKR RTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGP RDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTP AAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPR TLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
284+dbSNP:
284+c, gdbSNP:2484516
300+a, gdbSNP:2479049
470+a, gdbSNP:182999539
749+a, gdbSNP:1800545
972+c, tdbSNP:201376588
1074+a, gdbSNP:13306143
1084+c, gdbSNP:1800034
1085+a, cdbSNP:111872241
1130+c, tdbSNP:186847183
1190+c, gdbSNP:12416313
1217+c, tdbSNP:33944494
1257+a, gdbSNP:138797613
1346+c, gdbSNP:142434876
1370+c, tdbSNP:201396701
1452+c, tdbSNP:146469074
1463+a, gdbSNP:138747761
1495+c, tdbSNP:199783285
1548+a, gdbSNP:200592713
1647+a, gdbSNP:200814490
1653+a, gdbSNP:200429541
1667+c, gdbSNP:149350078
1763+c, gdbSNP:1800035
1792+, cgagcgcagcgcgggcccdbSNP:34007165
1793+g, tdbSNP:112643166
2103+a, cdbSNP:1800038
2115+g, tdbSNP:1800036
2120+c, gdbSNP:201475397
2200+c, tdbSNP:148162881
2211+a, tdbSNP:35658213
2216+c, tdbSNP:201804522
2237+a, gdbSNP:199567917
2258+c, tdbSNP:143027701
2260+g, tdbSNP:77286801
2382+c, gdbSNP:33931318
2402+a, tdbSNP:111623406
2405+c, tdbSNP:200026350
2493+a, tdbSNP:34303217
2503+a, tdbSNP:150599677
2579+a, cdbSNP:11195419
2715+c, gdbSNP:74156327
2790+c, tdbSNP:553668
2812+a, cdbSNP:3750625
2833+c, tdbSNP:186586025
2967+c, gdbSNP:41286894
3028+a, gdbSNP:149726935
3114+a, gdbSNP:13306144
3151+c, tdbSNP:147830111
3210+a, gdbSNP:13306145
3242+c, tdbSNP:193136246
3341+c, tdbSNP:112190526
3382+a, gdbSNP:13306146
3414+c, tdbSNP:139933303
3489+a, gdbSNP:116584564
3601+g, tdbSNP:185652968
3671+c, tdbSNP:188565562
3700+a, tdbSNP:12772798
3791+g, tdbSNP:12773548
3795+a, tdbSNP:12774664
3861+a, gdbSNP:145450349
Gene SymbolADRA2A
Gene SynonymADRA2; ADRA2R; ADRAR; ALPHA2AAR; ZNF32
Chromosome10
Locus Map10q25.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000681 Homo sapiens adrenoceptor alpha 2A (ADRA2A), mRNA. On-demand TBD TBD
Title Rab26 modulates the cell surface transport of alpha2-adrenergic receptors from the Golgi .
Author Li,C., Fan,Y., Lan,T.H., Lambert,N.A. and Wu,G.
Journal J. Biol. Chem. 287 (51), 42784-42794 (2012)
Title A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance .
Author Manning,A.K., Hivert,M.F., Scott,R.A., Grimsby,J.L., Bouatia-Naji,N., Chen,H., Rybin,D., Liu,C.T., Bielak,L.F., Prokopenko,I., Amin,N., Barnes,D., Cadby,G., Hottenga,J.J., Ingelsson,E., Jackson,A.U., Johnson,T., Kanoni,S., Ladenvall,C., Lagou,V., Lahti,J., Lecoeur,C., Liu,Y., Martinez-Larrad,M.T., Montasser,M.E., Navarro,P., Perry,J.R., Rasmussen-Torvik,L.J., Salo,P., Sattar,N., Shungin,D., Strawbridge,R.J., Tanaka,T., van Duijn,C.M., An,P., de Andrade,M., Andrews,J.S., Aspelund,T., Atalay,M., Aulchenko,Y., Balkau,B., Bandinelli,S., Beckmann,J.S., Beilby,J.P., Bellis,C., Bergman,R.N., Blangero,J., Boban,M., Boehnke,M., Boerwinkle,E., Bonnycastle,L.L., Boomsma,D.I., Borecki,I.B., Bottcher,Y., Bouchard,C., Brunner,E., Budimir,D., Campbell,H., Carlson,O., Chines,P.S., Clarke,R., Collins,F.S., Corbaton-Anchuelo,A., Couper,D., de Faire,U., Dedoussis,G.V., Deloukas,P., Dimitriou,M., Egan,J.M., Eiriksdottir,G., Erdos,M.R., Eriksson,J.G., Eury,E., Ferrucci,L., Ford,I., Forouhi,N.G., Fox,C.S., Franzosi,M.G., Franks,P.W., Frayling,T.M., Froguel,P., Galan,P., de Geus,E., Gigante,B., Glazer,N.L., Goel,A., Groop,L., Gudnason,V., Hallmans,G., Hamsten,A., Hansson,O., Harris,T.B., Hayward,C., Heath,S., Hercberg,S., Hicks,A.A., Hingorani,A., Hofman,A., Hui,J., Hung,J., Jarvelin,M.R., Jhun,M.A., Johnson,P.C., Jukema,J.W., Jula,A., Kao,W.H., Kaprio,J., Kardia,S.L., Keinanen-Kiukaanniemi,S., Kivimaki,M., Kolcic,I., Kovacs,P., Kumari,M., Kuusisto,J., Kyvik,K.O., Laakso,M., Lakka,T., Lannfelt,L., Lathrop,G.M., Launer,L.J., Leander,K., Li,G., Lind,L., Lindstrom,J., Lobbens,S., Loos,R.J., Luan,J., Lyssenko,V., Magi,R., Magnusson,P.K., Marmot,M., Meneton,P., Mohlke,K.L., Mooser,V., Morken,M.A., Miljkovic,I., Narisu,N., O'Connell,J., Ong,K.K., Oostra,B.A., Palmer,L.J., Palotie,A., Pankow,J.S., Peden,J.F., Pedersen,N.L., Pehlic,M., Peltonen,L., Penninx,B., Pericic,M., Perola,M., Perusse,L., Peyser,P.A., Polasek,O., Pramstaller,P.P., Province,M.A., Raikkonen,K., Rauramaa,R., Rehnberg,E., Rice,K., Rotter,J.I., Rudan,I., Ruokonen,A., Saaristo,T., Sabater-Lleal,M., Salomaa,V., Savage,D.B., Saxena,R., Schwarz,P., Seedorf,U., Sennblad,B., Serrano-Rios,M., Shuldiner,A.R., Sijbrands,E.J., Siscovick,D.S., Smit,J.H., Small,K.S., Smith,N.L., Smith,A.V., Stancakova,A., Stirrups,K., Stumvoll,M., Sun,Y.V., Swift,A.J., Tonjes,A., Tuomilehto,J., Trompet,S., Uitterlinden,A.G., Uusitupa,M., Vikstrom,M., Vitart,V., Vohl,M.C., Voight,B.F., Vollenweider,P., Waeber,G., Waterworth,D.M., Watkins,H., Wheeler,E., Widen,E., Wild,S.H., Willems,S.M., Willemsen,G., Wilson,J.F., Witteman,J.C., Wright,A.F., Yaghootkar,H., Zelenika,D., Zemunik,T., Zgaga,L., Wareham,N.J., McCarthy,M.I., Barroso,I., Watanabe,R.M., Florez,J.C., Dupuis,J., Meigs,J.B. and Langenberg,C.
Journal Nat. Genet. 44 (6), 659-669 (2012)
Title Alpha-adrenergic receptor gene polymorphisms and cardiovascular reactivity to stress in Black adolescents and young adults .
Author Kelsey,R.M., Alpert,B.S., Dahmer,M.K., Krushkal,J. and Quasney,M.W.
Journal Psychophysiology 49 (3), 401-412 (2012)
Title Promoter region of the human alpha 2A adrenergic receptor gene .
Author Handy,D.E. and Gavras,H.
Journal J. Biol. Chem. 267 (33), 24017-24022 (1992)
Title Differential expression of two alpha 2-adrenergic receptor subtype mRNAs in human tissues .
Author Perala,M., Hirvonen,H., Kalimo,H., Ala-Uotila,S., Regan,J.W., Akerman,K.E. and Scheinin,M.
Journal Brain Res. Mol. Brain Res. 16 (1-2), 57-63 (1992)
Title A point mutation of the alpha 2-adrenoceptor that blocks coupling to potassium but not calcium currents .
Author Surprenant,A., Horstman,D.A., Akbarali,H. and Limbird,L.E.
Journal Science 257 (5072), 977-980 (1992)
Title A point mutation in the seventh hydrophobic domain of the alpha 2 adrenergic receptor increases its affinity for a family of beta receptor antagonists .
Author Suryanarayana,S., Daunt,D.A., Von Zastrow,M. and Kobilka,B.K.
Journal J. Biol. Chem. 266 (23), 15488-15492 (1991)
Title Site-directed mutagenesis of alpha 2A-adrenergic receptors: identification of amino acids involved in ligand binding and receptor activation by agonists .
Author Wang,C.D., Buck,M.A. and Fraser,C.M.
Journal Mol. Pharmacol. 40 (2), 168-179 (1991)
Title Cloning, sequence analysis, and permanent expression of a human alpha 2-adrenergic receptor in Chinese hamster ovary cells. Evidence for independent pathways of receptor coupling to adenylate cyclase attenuation and activation .
Author Fraser,C.M., Arakawa,S., McCombie,W.R. and Venter,J.C.
Journal J. Biol. Chem. 264 (20), 11754-11761 (1989)
Title Cloning, sequencing, and expression of the gene coding for the human platelet alpha 2-adrenergic receptor .
Author Kobilka,B.K., Matsui,H., Kobilka,T.S., Yang-Feng,T.L., Francke,U., Caron,M.G., Lefkowitz,R.J. and Regan,J.W.
Journal Science 238 (4827), 650-656 (1987)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.