• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens aldehyde dehydrogenase 2 family (mitochondrial) (ALDH2), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23457 Homo sapiens aldehyde dehydrogenase 2 family (mitochondrial) (ALDH2), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu23457C Homo sapiens aldehyde dehydrogenase 2 family (mitochondrial) (ALDH2), transcript variant 1, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000690.3, 325910902
Length 1554 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens aldehyde dehydrogenase 2 family (mitochondrial) (ALDH2), transcript variant 1, mRNA.
Product aldehyde dehydrogenase, mitochondrial isoform 1 precursor
Comment

Summary: This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have the cytosolic isozyme but not the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of a catalytically active form of the mitochondrial isozyme. The increased exposure to acetaldehyde in individuals with the catalytically inactive form may also confer greater susceptibility to many types of cancer. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Mar 2011].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_000681.2
CDS 97..1650
Misc Feature(1)85..87
Misc Feature(2)103..1644
Misc Feature(3)187..1629
Misc Feature(4)order(361..366,376..378,385..387,391..393,403..405,
Misc Feature(5)order(640..651,721..723,730..732,820..822,832..837,
Misc Feature(6)order(652..654,949..951,1042..1044,1051..1053)
Misc Feature(7)652..654
Exon (1)1..210
Gene:ALDH2
Gene Synonym:ALDH-E2; ALDHI; ALDM
Exon (2)211..315
Gene:ALDH2
Gene Synonym:ALDH-E2; ALDHI; ALDM
Exon (3)316..456
Gene:ALDH2
Gene Synonym:ALDH-E2; ALDHI; ALDM
Exon (4)457..536
Gene:ALDH2
Gene Synonym:ALDH-E2; ALDHI; ALDM
Exon (5)537..648
Gene:ALDH2
Gene Synonym:ALDH-E2; ALDHI; ALDM
Exon (6)649..777
Gene:ALDH2
Gene Synonym:ALDH-E2; ALDHI; ALDM
Exon (7)778..891
Gene:ALDH2
Gene Synonym:ALDH-E2; ALDHI; ALDM
Exon (8)892..994
Gene:ALDH2
Gene Synonym:ALDH-E2; ALDHI; ALDM
Exon (9)995..1179
Gene:ALDH2
Gene Synonym:ALDH-E2; ALDHI; ALDM
Exon (10)1180..1344
Gene:ALDH2
Gene Synonym:ALDH-E2; ALDHI; ALDM
Exon (11)1345..1502
Gene:ALDH2
Gene Synonym:ALDH-E2; ALDHI; ALDM
Exon (12)1503..1617
Gene:ALDH2
Gene Synonym:ALDH-E2; ALDHI; ALDM
Exon (13)1618..2060
Gene:ALDH2
Gene Synonym:ALDH-E2; ALDHI; ALDM
Translation MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(24)-dbSNP:
complement(24)-g, adbSNP:186586514
47+a, gdbSNP:368926957
105+c, tdbSNP:6490301
135+c, gdbSNP:1064903
146+g, tdbSNP:372948453
168+c, tdbSNP:200369180
213+dbSNP:
213+g, tdbSNP:200757003
217+a, gdbSNP:141574314
228+a, gdbSNP:376595585
279+c, tdbSNP:146739827
310+a, gdbSNP:369662183
335+dbSNP:
335+c, tdbSNP:140347209
336+a, gdbSNP:142646023
343+a, gdbSNP:375845001
347+a, gdbSNP:199624420
351+c, tdbSNP:151016544
370+a, cdbSNP:201582342
377+a, gdbSNP:201745983
379+c, tdbSNP:140919090
403+c, tdbSNP:150202179
409+c, tdbSNP:13306164
416+g, tdbSNP:141696414
424+c, gdbSNP:147086207
432+c, tdbSNP:199967065
436+c, tdbSNP:190764869
439+a, gdbSNP:376099569
475+dbSNP:
475+a, gdbSNP:367911769
486+a, cdbSNP:138443541
516+c, gdbSNP:141373324
536+a, gdbSNP:371993659
544+dbSNP:
544+a, gdbSNP:141629803
546+a, cdbSNP:372921830
589+a, gdbSNP:144375294
607+a, tdbSNP:375708006
610+c, tdbSNP:368356402
633+c, tdbSNP:201725825
647+c, tdbSNP:191240032
660+a, gdbSNP:58280059
744+c, gdbSNP:144641798
747+c, tdbSNP:138201631
748+a, gdbSNP:377123780
828+dbSNP:
828+a, gdbSNP:139862632
837+c, tdbSNP:111277749
845+c, tdbSNP:111540940
898+dbSNP:
898+c, tdbSNP:201835306
925+a, gdbSNP:139133423
935..936+, adbSNP:71445558
946+c, tdbSNP:150631941
955+a, g, tdbSNP:145077856
965+a, gdbSNP:372262254
989+a, cdbSNP:148698157
991+a, gdbSNP:142271678
1005+dbSNP:
1005+c, tdbSNP:147887880
1006+a, gdbSNP:201108880
1011+a, gdbSNP:141555810
1067+a, gdbSNP:372053825
1082+a, tdbSNP:376029750
1106+a, tdbSNP:1062136
1108+c, tdbSNP:202226446
1113+c, tdbSNP:147049749
1119+c, tdbSNP:370850207
1146+c, tdbSNP:112460655
1167+a, gdbSNP:141025702
1203+dbSNP:
1203+a, gdbSNP:201721832
1222+a, gdbSNP:201023185
1224+a, gdbSNP:182362882
1236+c, gdbSNP:150253385
1241+c, tdbSNP:372769067
1271+c, tdbSNP:200738174
1287+c, tdbSNP:138931620
1294+c, tdbSNP:149442966
1303+c, tdbSNP:201705553
1350+dbSNP:
1350+c, tdbSNP:199811756
1385+c, tdbSNP:374377652
1387+a, gdbSNP:144598865
1398+c, tdbSNP:138505396
1402+a, cdbSNP:368435076
1419+a, gdbSNP:141556759
1470+c, tdbSNP:371851241
1477+c, gdbSNP:201405479
1559+dbSNP:
1559+c, tdbSNP:371493214
1560+a, gdbSNP:190914158
1563+a, gdbSNP:1064933
1570+c, tdbSNP:199724286
1587+c, tdbSNP:201939387
1606+a, gdbSNP:671
1658+dbSNP:
1658+a, gdbSNP:199997803
1662+a, gdbSNP:187335908
1688+a, gdbSNP:375668624
1693+a, gdbSNP:369765587
1729+c, tdbSNP:370433121
1777+a, gdbSNP:113787291
1803+c, tdbSNP:58352818
1928+c, tdbSNP:192282635
1942+c, tdbSNP:77603030
2008+c, tdbSNP:185494407
Gene SymbolALDH2
Gene SynonymALDH-E2; ALDHI; ALDM
Chromosome12
Locus Map12q24.2
Title Targeting aldehyde dehydrogenase 2: new therapeutic opportunities .
Author Chen,C.H., Ferreira,J.C., Gross,E.R. and Mochly-Rosen,D.
Journal Physiol. Rev. 94 (1), 1-34 (2014)
Title Functional polymorphism in aldehyde dehydrogenase-2 gene associated with risk of tuberculosis .
Author Park SK, Park CS, Lee HS, Park KS, Park BL, Cheong HS and Shin HD.
Journal BMC Med. Genet. 15, 40 (2014)
Title Variant ALDH2 is associated with accelerated progression of bone marrow failure in Japanese Fanconi anemia patients .
Author Hira A, Yabe H, Yoshida K, Okuno Y, Shiraishi Y, Chiba K, Tanaka H, Miyano S, Nakamura J, Kojima S, Ogawa S, Matsuo K, Takata M and Yabe M.
Journal Blood 122 (18), 3206-3209 (2013)
Title [A coexistence of the Dupuytren's disease and malignant neoplasms: a review] .
Author Zyluk,A. and Dibniak,T.
Journal Ann Acad Med Stetin 59 (1), 15-17 (2013)
Title Association between aldehyde dehydrogenase 2 polymorphisms and the incidence of diabetic retinopathy among Japanese subjects with type 2 diabetes mellitus .
Author Morita K, Saruwatari J, Miyagawa H, Uchiyashiki Y, Oniki K, Sakata M, Kajiwara A, Yoshida A, Jinnouchi H and Nakagawa K.
Journal Cardiovasc Diabetol 12, 132 (2013)
Title Molecular genetics of human aldehyde dehydrogenase .
Author Yoshida A.
Journal Pharmacogenetics 2 (4), 139-147 (1992)
Title Genotypes for aldehyde dehydrogenase deficiency and alcohol sensitivity. The inactive ALDH2(2) allele is dominant .
Author Crabb DW, Edenberg HJ, Bosron WF and Li TK.
Journal J. Clin. Invest. 83 (1), 314-316 (1989)
Title Genomic structure of the human mitochondrial aldehyde dehydrogenase gene .
Author Hsu LC, Bendel RE and Yoshida A.
Journal Genomics 2 (1), 57-65 (1988)
Title The structural gene for the mitochondrial aldehyde dehydrogenase maps to human chromosome 12 .
Author Braun,T., Grzeschik,K.H., Bober,E., Singh,S., Agarwal,D.P. and Goedde,H.W.
Journal Hum. Genet. 73 (4), 365-367 (1986)
Title Cloning of cDNAs for human aldehyde dehydrogenases 1 and 2 .
Author Hsu,L.C., Tani,K., Fujiyoshi,T., Kurachi,K. and Yoshida,A.
Journal Proc. Natl. Acad. Sci. U.S.A. 82 (11), 3771-3775 (1985)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.