• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cholinergic receptor, nicotinic, beta 2 (neuronal) (CHRNB2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000748 Homo sapiens cholinergic receptor, nicotinic, beta 2 (neuronal) (CHRNB2), mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_000748.2, 110618251
Length 5731 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens cholinergic receptor, nicotinic, beta 2 (neuronal) (CHRNB2), mRNA.
Product neuronal acetylcholine receptor subunit beta-2 precursor
Comment

Summary: Neuronal acetylcholine receptors are homo- or heteropentameric complexes composed of homologous alpha and beta subunits. They belong to a superfamily of ligand-gated ion channels which allow the flow of sodium and potassium across the plasma membrane in response to ligands such as acetylcholine and nicotine. This gene encodes one of several beta subunits. Mutations in this gene are associated with autosomal dominant nocturnal frontal lobe epilepsy. [provided by RefSeq, Jul 2008].

RefSeq NP_000739.1
CDS 265..1773
Misc Feature(1)112..114
Misc Feature(2)349..1701
Misc Feature(3)349..966
Misc Feature(4)964..1038
Misc Feature(5)985..1698
Misc Feature(6)1060..1116
Misc Feature(7)1162..1227
Misc Feature(8)1639..1698
Exon (1)1..328
Gene:CHRNB2
Gene Synonym:EFNL3; nAChRB2
Exon (2)329..474
Gene:CHRNB2
Gene Synonym:EFNL3; nAChRB2
Exon (3)475..519
Gene:CHRNB2
Gene Synonym:EFNL3; nAChRB2
Exon (4)520..629
Gene:CHRNB2
Gene Synonym:EFNL3; nAChRB2
Exon (5)630..1602
Gene:CHRNB2
Gene Synonym:EFNL3; nAChRB2
Exon (6)1603..5719
Gene:CHRNB2
Gene Synonym:EFNL3; nAChRB2
Translation MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR TEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR LRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ PLFQNYTTTTFLHSDHSAPSSK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
31+dbSNP:
31+c, gdbSNP:112480976
38+c, gdbSNP:200772055
51+a, gdbSNP:12062049
52+a, gdbSNP:200136206
58+c, gdbSNP:200941077
65+c, tdbSNP:201787326
66+a, cdbSNP:199925735
95+c, tdbSNP:200933515
105+a, gdbSNP:138709951
109+c, tdbSNP:200453718
115+a, gdbSNP:183393371
130+a, gdbSNP:201327396
132+a, gdbSNP:111585219
138+c, tdbSNP:201980297
139+g, tdbSNP:200436688
143+a, cdbSNP:56205574
172+a, gdbSNP:199637367
210+c, tdbSNP:55799808
212+c, tdbSNP:2280781
214+a, cdbSNP:111862660
225+c, tdbSNP:200611616
258+c, tdbSNP:78492812
338+dbSNP:
338+c, gdbSNP:76005585
341+c, tdbSNP:71651692
342+a, gdbSNP:143402032
352+a, gdbSNP:199919525
355+c, tdbSNP:145926853
362+g, tdbSNP:200729328
365+c, tdbSNP:200223952
369+a, tdbSNP:141689121
373+c, tdbSNP:71651693
386+a, gdbSNP:199999862
387+a, cdbSNP:201171352
414+c, tdbSNP:149921259
417+c, tdbSNP:201747045
500+dbSNP:
500+a, cdbSNP:200382306
503+a, gdbSNP:201218199
528+dbSNP:
528+a, gdbSNP:200792295
536+a, gdbSNP:144508607
550+c, tdbSNP:201948726
593+a, cdbSNP:199885651
612+c, tdbSNP:78921047
636+dbSNP:
636+c, tdbSNP:151054217
645+c, tdbSNP:201024705
659+a, gdbSNP:141056449
661+c, tdbSNP:199838048
679+c, tdbSNP:200290014
686+a, gdbSNP:201542724
696+c, tdbSNP:199536721
747+c, tdbSNP:190967991
772+a, gdbSNP:201000891
788+c, g, tdbSNP:75760566
810+g, tdbSNP:199696100
857+c, tdbSNP:200583300
879+c, tdbSNP:202243284
884+c, gdbSNP:201622476
895+c, tdbSNP:200108220
910+a, cdbSNP:200796605
938+a, cdbSNP:201952018
943+a, gdbSNP:199891624
956+a, gdbSNP:201373530
959+a, gdbSNP:79646221
966+a, gdbSNP:200050755
972+c, tdbSNP:71628622
983+a, cdbSNP:200845052
998+g, tdbSNP:201130412
999+c, tdbSNP:201691696
1014+a, gdbSNP:200380724
1036+c, tdbSNP:201514209
1053+c, tdbSNP:202199860
1061+a, tdbSNP:113672425
1065+a, gdbSNP:200331379
1088+c, tdbSNP:201393088
1089+a, gdbSNP:140739605
1123+a, c, g, tdbSNP:74315291
1165+c, gdbSNP:281865069
1183+a, cdbSNP:200720061
1187+c, tdbSNP:281865070
1192+c, tdbSNP:201366539
1200+c, gdbSNP:281865071
1209+c, tdbSNP:199549612
1232+a, gdbSNP:201004255
1247+c, tdbSNP:145893879
1254+c, tdbSNP:201825924
1266+c, gdbSNP:200048991
1267+a, gdbSNP:200666765
1274+g, tdbSNP:281865072
1291+c, tdbSNP:201328638
1298+c, tdbSNP:141511378
1310+c, tdbSNP:141735618
1322+a, gdbSNP:200924076
1325+a, cdbSNP:201793956
1348+c, tdbSNP:199928622
1351+c, tdbSNP:201040879
1367+g, tdbSNP:202114705
1373+c, gdbSNP:200483865
1392+c, tdbSNP:113116986
1397+a, tdbSNP:113488072
1398+c, tdbSNP:112744508
1410+a, cdbSNP:201986342
1454..1455+, adbSNP:35834206
1454+a, cdbSNP:200441832
1455+c, gdbSNP:55685423
1468+a, gdbSNP:199658508
1497+a, gdbSNP:55857552
1499+a, gdbSNP:112585933
1521+a, gdbSNP:199743038
1530+a, cdbSNP:76126473
1537+c, tdbSNP:77710036
1578+a, gdbSNP:200910048
1602+c, tdbSNP:201462348
1617+c, gdbSNP:201110967
1639+a, gdbSNP:140505576
1642+c, g, tdbSNP:202079239
1671+c, gdbSNP:138886952
1679+c, tdbSNP:200855905
1687+a, cdbSNP:202135710
1690+a, gdbSNP:200467784
1696+c, tdbSNP:79137415
1746+a, gdbSNP:8192486
1749+c, tdbSNP:144813907
1752+c, tdbSNP:200582284
1791+a, gdbSNP:199567352
1805+a, tdbSNP:1126885
1814+c, gdbSNP:201199916
1829+a, gdbSNP:199714428
1834+a, gdbSNP:200519583
1846+c, tdbSNP:201340494
1847+a, gdbSNP:199747394
1856+a, gdbSNP:200913790
1867+a, gdbSNP:201699993
1868+a, gdbSNP:71651697
1869+a, gdbSNP:201216419
1870+c, tdbSNP:201869390
1875+c, tdbSNP:199967217
1877+c, tdbSNP:200963221
1886+c, gdbSNP:2072659
1917+c, tdbSNP:200543651
1923+a, c, tdbSNP:201303449
1925+c, tdbSNP:202031218
1972+g, tdbSNP:200252337
1983+c, tdbSNP:201024155
1984+c, gdbSNP:199833512
1988+c, tdbSNP:200295099
1991+a, gdbSNP:201141086
1992+c, tdbSNP:199545188
1993+a, c, tdbSNP:200917319
1997+g, tdbSNP:201694281
2004+a, gdbSNP:115971480
2016+c, gdbSNP:200573025
2040+c, tdbSNP:34019399
2041+c, tdbSNP:201622270
2045+c, tdbSNP:111787379
2063+a, gdbSNP:200726730
2074+c, tdbSNP:201735146
2086+c, tdbSNP:2072660
2109+a, cdbSNP:200930444
2110+a, gdbSNP:202226324
2111+c, gdbSNP:185796768
2145+c, gdbSNP:200050649
2184+c, tdbSNP:188760947
2185+a, gdbSNP:78691486
2189+c, tdbSNP:193194163
2190+a, gdbSNP:201710469
2192+a, gdbSNP:202034594
2206+a, gdbSNP:185006462
2218+a, tdbSNP:201303081
2232+a, gdbSNP:199797230
2245+a, gdbSNP:2072661
2255+a, cdbSNP:201351693
2258+c, tdbSNP:199579680
2261+c, tdbSNP:116171514
2263+c, tdbSNP:202044279
2299+c, tdbSNP:199996766
2311+c, tdbSNP:4292956
2312+a, gdbSNP:201632996
2323+a, cdbSNP:200156184
2328+a, gdbSNP:200934493
2336+c, tdbSNP:201796200
2337+g, tdbSNP:199934611
2342+c, tdbSNP:200933616
2355+, cdbSNP:35522129
2357+c, tdbSNP:45490696
2360+a, gdbSNP:188551694
2374+a, gdbSNP:200457733
2379+c, gdbSNP:201515151
2391+c, tdbSNP:201972090
2430+c, tdbSNP:200468520
2443+a, gdbSNP:201449153
2463+c, tdbSNP:199691850
2476+c, gdbSNP:200357779
2500+g, tdbSNP:201326506
2505+a, gdbSNP:199780070
2542+a, tdbSNP:200792380
2561+c, gdbSNP:201953457
2569+a, gdbSNP:199604654
2575+a, gdbSNP:200718903
2578+a, gdbSNP:201580225
2610+a, gdbSNP:200038311
2623+a, gdbSNP:201174358
2646+c, tdbSNP:145945679
2657+a, gdbSNP:111608501
2667+a, tdbSNP:201634297
2684+c, gdbSNP:200184943
2688+c, tdbSNP:201180392
2737+c, tdbSNP:202070050
2745+c, tdbSNP:200263890
2746+c, gdbSNP:200839600
2751+c, gdbSNP:202149047
2760+c, tdbSNP:200444544
2761+c, tdbSNP:201539843
2781+c, gdbSNP:78080997
2787+c, tdbSNP:199542459
2790+a, tdbSNP:200636354
2791+c, gdbSNP:201206167
2808+a, gdbSNP:199725692
2823+a, cdbSNP:200523765
2835+c, tdbSNP:12130403
2836+a, gdbSNP:139826441
2856+c, gdbSNP:12125018
2859+c, tdbSNP:200796860
2880+c, tdbSNP:181089470
2886+g, tdbSNP:199869460
2896+a, gdbSNP:201043062
2904+c, tdbSNP:201858389
2905+a, gdbSNP:199997326
2923+c, tdbSNP:200960069
2944+c, tdbSNP:201980216
2948+c, gdbSNP:200595931
2949+a, gdbSNP:201184597
2958+c, tdbSNP:202201712
2967+c, tdbSNP:200338192
3007+c, tdbSNP:201024958
3008+a, gdbSNP:201880613
3029+c, tdbSNP:200292500
3030+c, tdbSNP:201140877
3031+a, gdbSNP:199566035
3043+a, cdbSNP:200994061
3093+c, tdbSNP:201542024
3102+a, gdbSNP:199666962
3107+c, tdbSNP:183661862
3137+c, gdbSNP:201608223
3149+c, gdbSNP:200114425
3184+c, tdbSNP:116773421
3186+c, gdbSNP:201756422
3188+g, tdbSNP:199883511
3199+a, gdbSNP:201074604
3203+a, gdbSNP:202116035
3208+a, gdbSNP:200070990
3215+c, gdbSNP:200845417
3216+a, cdbSNP:71628623
3231+a, gdbSNP:201693370
3244+a, gdbSNP:200382952
3250+c, tdbSNP:201201536
3268+c, tdbSNP:202208278
3323+a, tdbSNP:200322298
3338+c, tdbSNP:201424151
3354+a, gdbSNP:199740852
3416+c, tdbSNP:200732572
3428..3429+, cadbSNP:75857876
3429+a, gdbSNP:201350223
3430+c, gdbSNP:199579240
3446+c, tdbSNP:200828030
3452+c, tdbSNP:188276626
3459+a, tdbSNP:200046151
3491+c, tdbSNP:200668619
3502+c, tdbSNP:201826743
3508+a, tdbSNP:200156449
3511+c, tdbSNP:200934414
3535+c, gdbSNP:78614862
3536+c, gdbSNP:199960573
3538+c, tdbSNP:200738385
3549+a, gdbSNP:76242649
3579+a, gdbSNP:202143953
3589+c, gdbSNP:200469143
3625+a, gdbSNP:201069070
3633+a, tdbSNP:202148264
3670+a, cdbSNP:200468468
3681+a, gdbSNP:201452114
3707+c, tdbSNP:199694457
3712+c, gdbSNP:142105069
3717+a, gdbSNP:201424237
3726+g, tdbSNP:199748893
3738+c, tdbSNP:151180783
3754+g, tdbSNP:201698776
3770+a, gdbSNP:199604285
3775+g, tdbSNP:200757123
3778+c, tdbSNP:200037268
3794+c, tdbSNP:201569830
3812+a, gdbSNP:200050160
3828+c, tdbSNP:201040578
3829+a, gdbSNP:201862599
3835+c, tdbSNP:200152526
3849+c, gdbSNP:201303323
3855+c, tdbSNP:202032765
3856+a, gdbSNP:200264450
3870+c, gdbSNP:200846386
3884..3885+, tcdbSNP:146345695
3894+a, gdbSNP:202151842
3904+g, tdbSNP:200351372
3920+c, gdbSNP:201431543
3968+a, c, tdbSNP:199543295
3980+a, gdbSNP:200585814
3983+c, tdbSNP:201721712
3988+a, gdbSNP:199706962
4010+c, gdbSNP:200552524
4037+a, gdbSNP:201326987
4040+a, cdbSNP:199858284
4082+c, tdbSNP:200897511
4083+a, gdbSNP:79916715
4089+c, tdbSNP:6680410
4110+c, gdbSNP:200935724
4123+a, gdbSNP:201859923
4135+c, tdbSNP:200000696
4140+c, tdbSNP:200965246
4143+c, tdbSNP:201988115
4146+c, tdbSNP:200156045
4153+c, tdbSNP:201305703
4199+c, gdbSNP:202036250
4212+a, tdbSNP:200359874
4217+c, tdbSNP:201326726
4218+a, gdbSNP:201875171
4236+c, gdbSNP:200314406
4238+c, gdbSNP:74836199
4239+a, gdbSNP:201128885
4244+c, gdbSNP:199601248
4277+c, tdbSNP:200901346
4293+a, cdbSNP:201722872
4306+g, tdbSNP:199650981
4309..4310+, agdbSNP:3841062
4310+c, gdbSNP:200801083
4311+a, cdbSNP:201609634
4313+c, gdbSNP:200115533
4317+c, tdbSNP:200730407
4352+a, gdbSNP:180857424
4369+a, gdbSNP:201757620
4375+c, tdbSNP:199931787
4397+c, tdbSNP:3811450
4402+a, cdbSNP:202234764
4458+a, gdbSNP:200013447
4460+a, cdbSNP:187654016
4465+a, cdbSNP:200866106
4489+a, tdbSNP:201681907
4496+a, gdbSNP:200399366
4509+c, tdbSNP:201202710
4530+c, gdbSNP:202064422
4534+c, tdbSNP:200371411
4539+a, cdbSNP:201331027
4547+a, gdbSNP:199783292
4551+c, tdbSNP:200794243
4552+a, gdbSNP:201357879
4556+c, gdbSNP:199585594
4565+c, tdbSNP:200829166
4582+a, cdbSNP:201869574
4590+a, c, gdbSNP:200023197
4612+a, cdbSNP:200787773
4613+c, tdbSNP:201640720
4618+a, cdbSNP:200183281
4629+c, tdbSNP:191830859
4633+g, tdbSNP:201482447
4635+c, tdbSNP:199962088
4636+a, cdbSNP:200739937
4662+a, g, tdbSNP:202236367
4663+a, gdbSNP:200448469
4691+a, gdbSNP:181938695
4697+a, gdbSNP:201963457
4705+c, gdbSNP:200474662
4720+c, tdbSNP:185988524
4723+c, gdbSNP:201452330
4726+c, gdbSNP:199696071
4733+a, gdbSNP:4845653
4764+c, gdbSNP:201252126
4771+a, cdbSNP:199813635
4799+a, tdbSNP:200780833
4835+g, tdbSNP:201972583
4847+c, tdbSNP:199557213
4863+g, tdbSNP:200450476
4875+c, tdbSNP:201571371
4876+a, gdbSNP:200051795
4883+c, tdbSNP:200848264
4904+c, tdbSNP:201641917
4915+g, tdbSNP:1139339
4929+c, tdbSNP:190311254
4946+c, tdbSNP:201186494
4952+a, gdbSNP:202201948
4974+a, gdbSNP:200264628
4980+a, gdbSNP:200847877
4982+c, gdbSNP:112028541
4984+c, gdbSNP:202139749
4999+c, tdbSNP:200372350
5000+a, gdbSNP:201525800
5006+c, tdbSNP:199564931
5010+a, gdbSNP:200627830
5011+c, tdbSNP:201542202
5022+c, g, tdbSNP:199707249
5023+a, gdbSNP:200554162
5049+a, gdbSNP:149932359
5065+a, tdbSNP:199860941
5082+c, tdbSNP:11264221
5093+a, cdbSNP:201973469
5114+c, tdbSNP:199883720
5116+c, tdbSNP:147631259
5138+c, gdbSNP:201847586
5149+a, gdbSNP:199981580
5151+c, gdbSNP:200991937
5157+a, tdbSNP:201969447
5161+c, tdbSNP:200133979
5179+c, tdbSNP:201171705
5183+c, tdbSNP:202208652
5184+a, c, gdbSNP:142290757
5194+c, tdbSNP:201422275
5197+a, gdbSNP:201876654
5207+c, gdbSNP:200320776
5210+c, gdbSNP:182800795
5230+a, gdbSNP:201128959
5236+a, c, gdbSNP:187084916
5248+a, gdbSNP:190033368
5257+a, tdbSNP:201548688
5264+c, gdbSNP:199670291
5272+a, gdbSNP:200668286
5273+c, tdbSNP:201858235
5291+c, tdbSNP:182534342
5324+c, tdbSNP:200747099
5336+a, gdbSNP:201736536
5351+a, gdbSNP:189086635
5352+c, tdbSNP:201032420
5357+c, tdbSNP:202145709
5369+a, gdbSNP:200059610
5373+c, tdbSNP:201069736
5374+c, gdbSNP:201685713
5376+c, gdbSNP:200399705
5380+a, gdbSNP:201204412
5385+c, tdbSNP:201802600
5390+a, gdbSNP:200328376
5408+c, tdbSNP:201428541
5410+c, tdbSNP:199772208
5413+c, tdbSNP:200895915
5421+c, tdbSNP:201380244
5423+c, tdbSNP:199562773
5454+c, tdbSNP:200501202
5458+c, gdbSNP:147029267
5466+a, gdbSNP:199697602
5472+a, gdbSNP:200664085
5482+c, tdbSNP:147661842
5502+a, gdbSNP:200154428
5506+c, tdbSNP:201303793
5509+a, gdbSNP:201483896
5512+a, gdbSNP:199972741
5518+c, tdbSNP:200745309
5523+c, tdbSNP:201882150
5526+a, cdbSNP:61682683
5530+a, gdbSNP:200473686
5582+a, gdbSNP:185362017
5591+a, gdbSNP:201065728
5592+a, cdbSNP:202176027
5597+a, gdbSNP:200559692
5613+a, cdbSNP:201474856
5627+a, cdbSNP:199675244
5669+c, gdbSNP:200269196
5681+g, tdbSNP:201253265
5717+a, gdbSNP:199775959
Gene SymbolCHRNB2
Gene SynonymEFNL3; nAChRB2
Chromosome1
Locus Map1q21.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000748 Homo sapiens cholinergic receptor, nicotinic, beta 2 (neuronal) (CHRNB2), mRNA. In-stock $509.00 $460.00 12
Title NMR resolved multiple anesthetic binding sites in the TM domains of the alpha4beta2 nAChR .
Author Bondarenko,V., Mowrey,D., Liu,L.T., Xu,Y. and Tang,P.
Journal Biochim. Biophys. Acta 1828 (2), 398-404 (2013)
Title Varenicline for smoking cessation: nausea severity and variation in nicotinic receptor genes .
Author Swan,G.E., Javitz,H.S., Jack,L.M., Wessel,J., Michel,M., Hinds,D.A., Stokowksi,R.P., McClure,J.B., Catz,S.L., Richards,J., Zbikowski,S.M., Deprey,M., McAfee,T., Conti,D.V. and Bergen,A.W.
Journal Pharmacogenomics J. 12 (4), 349-358 (2012)
Title Structural characterization of binding mode of smoking cessation drugs to nicotinic acetylcholine receptors through study of ligand complexes with acetylcholine-binding protein .
Author Rucktooa,P., Haseler,C.A., van Elk,R., Smit,A.B., Gallagher,T. and Sixma,T.K.
Journal J. Biol. Chem. 287 (28), 23283-23293 (2012)
Title Changes in temperature have opposing effects on current amplitude in alpha7 and alpha4beta2 nicotinic acetylcholine receptors .
Author Jindrichova,M., Lansdell,S.J. and Millar,N.S.
Journal PLoS ONE 7 (2), E32073 (2012)
Title Additional acetylcholine (ACh) binding site at alpha4/alpha4 interface of (alpha4beta2)2alpha4 nicotinic receptor influences agonist sensitivity .
Author Mazzaferro,S., Benallegue,N., Carbone,A., Gasparri,F., Vijayan,R., Biggin,P.C., Moroni,M. and Bermudez,I.
Journal J. Biol. Chem. 286 (35), 31043-31054 (2011)
Title Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32 .
Author Groot Kormelink,P.J. and Luyten,W.H.
Journal FEBS Lett. 400 (3), 309-314 (1997)
Title Human alpha4beta2 neuronal nicotinic acetylcholine receptor in HEK 293 cells: A patch-clamp study .
Author Buisson,B., Gopalakrishnan,M., Arneric,S.P., Sullivan,J.P. and Bertrand,D.
Journal J. Neurosci. 16 (24), 7880-7891 (1996)
Title Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits .
Author Elliott,K.J., Ellis,S.B., Berckhan,K.J., Urrutia,A., Chavez-Noriega,L.E., Johnson,E.C., Velicelebi,G. and Harpold,M.M.
Journal J. Mol. Neurosci. 7 (3), 217-228 (1996)
Title Chromosomal localization of seven neuronal nicotinic acetylcholine receptor subunit genes in humans .
Author Anand,R. and Lindstrom,J.
Journal Genomics 13 (4), 962-967 (1992)
Title Nucleotide sequence of the human nicotinic acetylcholine receptor beta 2 subunit gene .
Author Anand,R. and Lindstrom,J.
Journal Nucleic Acids Res. 18 (14), 4272 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.