• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000773 Homo sapiens cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_000773.3, 75709190
Length 1667 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mRNA.
Product cytochrome P450 2E1 precursor
Comment

Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer. [provided by RefSeq, Jul 2008].

RefSeq NP_000764.1
CDS 34..1515
Misc Feature(1)130..1500
Misc Feature(2)925..942
Misc Feature(3)1342..1344
Exon (1)1..210
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (2)211..370
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (3)371..520
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (4)521..681
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (5)682..858
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (6)859..1000
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (7)1001..1188
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (8)1189..1330
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (9)1331..1667
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Translation MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRL AQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGP TWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVI ADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVA EVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRF ITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK FKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGC IPPRYKLCVIPRS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
1..2+dbSNP:
1..2+, cdbSNP:397709571
2+c, tdbSNP:200292747
3+c, tdbSNP:201519230
5+c, tdbSNP:374647442
6+c, gdbSNP:371502619
75+a, gdbSNP:375169910
82+c, tdbSNP:367957731
90+g, tdbSNP:201068922
109+a, gdbSNP:59868347
143..144+, cdbSNP:72559707
146+c, gdbSNP:76271067
147+a, gdbSNP:137875795
175+c, tdbSNP:369847743
188+a, gdbSNP:143746211
192..193+, cdbSNP:72559709
207+c, gdbSNP:114535864
220+dbSNP:
220+c, gdbSNP:374426412
226+a, gdbSNP:80297454
240+a, gdbSNP:77188198
247+c, gdbSNP:35844228
260+a, c, gdbSNP:72559710
262+a, gdbSNP:78902616
327+a, gdbSNP:28371740
400+dbSNP:
400+a, gdbSNP:377658981
409+c, tdbSNP:60719153
410+a, gdbSNP:56864127
411+a, gdbSNP:143942558
430+c, tdbSNP:148644999
469+c, tdbSNP:370419762
482+a, cdbSNP:200955165
492+c, tdbSNP:372241274
494+g, tdbSNP:373427672
495+g, tdbSNP:185896416
500+a, tdbSNP:142907528
526+dbSNP:
526+c, gdbSNP:201167793
531+c, tdbSNP:75795289
549+c, tdbSNP:139133362
550+a, gdbSNP:60452492
556+a, gdbSNP:56040284
568+a, gdbSNP:6413419
573+a, gdbSNP:201427783
576+c, g, tdbSNP:79549556
577+a, gdbSNP:76138620
589+c, tdbSNP:140500826
590+a, gdbSNP:200871390
645+c, tdbSNP:28371743
663+c, tdbSNP:368615861
688+dbSNP:
688+a, gdbSNP:41299426
689+a, gdbSNP:78313785
699+a, cdbSNP:374547066
739+a, tdbSNP:375484572
765+a, gdbSNP:369888957
792+c, tdbSNP:200017188
820+c, tdbSNP:372834832
832+a, gdbSNP:201869253
843+c, tdbSNP:370454377
853+c, gdbSNP:372404508
876+dbSNP:
876+a, gdbSNP:374287303
877+c, tdbSNP:375149895
886+a, gdbSNP:138201091
895+a, gdbSNP:61710826
903+c, tdbSNP:149170969
915+c, tdbSNP:367879853
918+c, tdbSNP:201925769
924+c, tdbSNP:143114791
933+c, gdbSNP:34767794
941+a, cdbSNP:201120875
942+a, cdbSNP:28371746
951+a, cdbSNP:372112053
967+c, tdbSNP:374740281
974+g, tdbSNP:142845267
996+c, tdbSNP:915909
997+a, gdbSNP:138223492
1026+dbSNP:
1026+a, gdbSNP:376820271
1042+c, tdbSNP:200228968
1056+c, gdbSNP:61644766
1077+c, gdbSNP:146344065
1082+g, tdbSNP:150514905
1118+c, tdbSNP:372279263
1130+c, gdbSNP:41299434
1150+a, gdbSNP:59981143
1152+c, tdbSNP:200439431
1153+c, gdbSNP:370530375
1187+a, gdbSNP:199856651
1198+dbSNP:
1198+a, g, tdbSNP:55897648
1214+a, gdbSNP:60207639
1219+c, gdbSNP:59656378
1249+c, gdbSNP:200177135
1271+a, gdbSNP:369048851
1286+a, gdbSNP:57702102
1296+c, tdbSNP:2515641
1303+a, gdbSNP:142767992
1318+c, gdbSNP:151041343
1363+dbSNP:
1363+c, tdbSNP:140969399
1368+c, gdbSNP:199855848
1391+c, tdbSNP:369066427
1403+a, tdbSNP:28969387
1422+c, tdbSNP:149793864
1423+a, gdbSNP:187941410
1440+c, tdbSNP:371128346
1441+a, gdbSNP:199954662
1484+a, gdbSNP:55982231
1508+a, gdbSNP:147916524
1534+a, gdbSNP:374012342
1537+c, tdbSNP:7081484
1542+c, tdbSNP:370566113
complement(1556)-t, adbSNP:2480257
1560+a, cdbSNP:56307258
complement(1561)-t, cdbSNP:2480256
1567+c, tdbSNP:11101812
1647+a, cdbSNP:12164704
Gene SymbolCYP2E1
Gene SynonymCPE1; CYP2E; P450-J; P450C2E
Chromosome10
Locus Map10q26.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000773 Homo sapiens cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mRNA. In-stock $509.00 $460.00 12
Title Inhibitory potency of 4-carbon alkanes and alkenes toward CYP2E1 activity .
Author Hartman JH, Miller GP and Boysen G.
Journal Toxicology 318, 51-58 (2014)
Title Role and importance of polymorphisms with respect to DNA methylation for the expression of CYP2E1 enzyme .
Author Naselli F, Catanzaro I, Bellavia D, Perez A, Sposito L and Caradonna F.
Journal Gene 536 (1), 29-39 (2014)
Title A regulatory variant in CYP2E1 affects the risk of lung squamous cell carcinoma .
Author Cao L, Lin J, He B, Wang H, Rao J, Liu Y and Zhang X.
Journal Tumour Biol. 35 (1), 455-462 (2014)
Title [Polymorphism of ethanol metabolism genes in alcoholic chronic pancreatitis] .
Author Gubergrits,N.B., Kishenya,M.S. and Golubova,O.A.
Journal Ter. Arkh. 86 (2), 49-55 (2014)
Title HIV gp120- and methamphetamine-mediated oxidative stress induces astrocyte apoptosis via cytochrome P450 2E1 .
Author Shah A, Kumar S, Simon SD, Singh DP and Kumar A.
Journal Cell Death Dis 4, E850 (2013)
Title Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants .
Author Nelson DR, Zeldin DC, Hoffman SM, Maltais LJ, Wain HM and Nebert DW.
Journal Pharmacogenetics 14 (1), 1-18 (2004)
Title MspI polymorphism of the human CYP2E gene .
Author Uematsu F, Kikuchi H, Abe T, Motomiya M, Ohmachi T, Sagami I and Watanabe M.
Journal Nucleic Acids Res. 19 (20), 5797 (1991)
Title Genetic polymorphisms in the 5'-flanking region change transcriptional regulation of the human cytochrome P450IIE1 gene .
Author Hayashi S, Watanabe J and Kawajiri K.
Journal J. Biochem. 110 (4), 559-565 (1991)
Title Human liver cytochrome P-450 related to a rat acetone-inducible, nitrosamine-metabolizing cytochrome P-450: identification and isolation .
Author Robinson RC, Shorr RG, Varrichio A, Park SS, Gelboin HV, Miller H and Friedman FK.
Journal Pharmacology 39 (3), 137-144 (1989)
Title Human ethanol-inducible P450IIE1: complete gene sequence, promoter characterization, chromosome mapping, and cDNA-directed expression .
Author Umeno M, McBride OW, Yang CS, Gelboin HV and Gonzalez FJ.
Journal Biochemistry 27 (25), 9006-9013 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.