• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mRNA.


RefSeq Accession Definition Services Price Order
NM_000773 Homo sapiens cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mRNA. ORF Sequence $429.78
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000773.3, 75709190
Length 1667 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mRNA.
Product cytochrome P450 2E1
Comment

Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer. [provided by RefSeq, Jul 2008].

RefSeq NP_000764.1
CDS 34..1515
Misc Feature(1)166..1509
Misc Feature(2)166..1509
Misc Feature(3)166..1500
Misc Feature(4)925..942
Misc Feature(5)1342..1344
Exon (1)1..210
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (2)211..370
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (3)371..520
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (4)521..681
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (5)682..858
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (6)859..1000
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (7)1001..1188
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (8)1189..1330
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Exon (9)1331..1667
Gene:CYP2E1
Gene Synonym:CPE1; CYP2E; P450-J; P450C2E
Translation MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRL AQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGP TWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVI ADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVA EVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRF ITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK FKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGC IPPRYKLCVIPRS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
1..2+dbSNP:
1..2+, cdbSNP:11445593
2+c, tdbSNP:200292747
3+c, tdbSNP:201519230
90+g, tdbSNP:201068922
109+a, gdbSNP:59868347
143..144+, cdbSNP:72559707
143+, c, ct, tdbSNP:72559706
146+c, gdbSNP:76271067
147+a, gdbSNP:137875795
188+a, gdbSNP:143746211
192..193+, cdbSNP:72559709
192+, c, ct, tdbSNP:72559708
207+c, gdbSNP:114535864
226+dbSNP:
226+a, gdbSNP:80297454
240+a, gdbSNP:77188198
247+c, gdbSNP:35844228
260+a, c, gdbSNP:72559710
262+a, gdbSNP:78902616
327+a, gdbSNP:28371740
409+dbSNP:
409+c, tdbSNP:60719153
410+a, gdbSNP:56864127
411+a, gdbSNP:143942558
430+c, tdbSNP:148644999
482+a, cdbSNP:200955165
495+g, tdbSNP:185896416
500+a, tdbSNP:142907528
526+dbSNP:
526+c, gdbSNP:201167793
531+c, tdbSNP:75795289
549+c, tdbSNP:139133362
550+a, gdbSNP:60452492
556+a, gdbSNP:56040284
568+a, gdbSNP:6413419
573+a, gdbSNP:201427783
576+c, gdbSNP:79549556
577+a, gdbSNP:76138620
589+c, tdbSNP:140500826
590+a, gdbSNP:200871390
645+c, tdbSNP:28371743
688+dbSNP:
688+a, gdbSNP:41299426
689+a, gdbSNP:78313785
792+c, tdbSNP:200017188
832+a, gdbSNP:201869253
886+dbSNP:
886+a, gdbSNP:138201091
895+a, gdbSNP:61710826
903+c, tdbSNP:149170969
918+c, tdbSNP:201925769
924+c, tdbSNP:143114791
933+c, gdbSNP:34767794
941+a, cdbSNP:201120875
942+a, cdbSNP:28371746
974+g, tdbSNP:142845267
996+c, tdbSNP:915909
997+a, gdbSNP:138223492
1042+dbSNP:
1042+c, tdbSNP:200228968
1056+c, gdbSNP:61644766
1077+c, gdbSNP:146344065
1082+g, tdbSNP:150514905
1130+c, gdbSNP:41299434
1150+a, gdbSNP:59981143
1152+c, tdbSNP:200439431
1158+c, gdbSNP:149273469
1187+a, gdbSNP:199856651
1198+dbSNP:
1198+a, g, tdbSNP:55897648
1214+a, gdbSNP:60207639
1219+c, gdbSNP:59656378
1249+c, gdbSNP:200177135
1286+a, gdbSNP:57702102
1296+c, tdbSNP:2515641
1303+a, gdbSNP:142767992
1318+c, gdbSNP:151041343
1363+dbSNP:
1363+c, tdbSNP:140969399
1368+c, gdbSNP:199855848
1403+a, tdbSNP:28969387
1422+c, tdbSNP:149793864
1423+a, gdbSNP:187941410
1441+a, gdbSNP:199954662
1484+a, gdbSNP:55982231
1508+a, gdbSNP:147916524
1537+c, tdbSNP:7081484
1556+a, tdbSNP:2480257
1560+a, cdbSNP:56307258
1561+c, tdbSNP:2480256
1567+c, tdbSNP:11101812
1647+a, cdbSNP:12164704
Gene SymbolCYP2E1
Gene SynonymCPE1; CYP2E; P450-J; P450C2E
Chromosome10
Locus Map10q24.3-qter
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000773 Homo sapiens cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mRNA. Full Length $483.43
ORF Sequence $429.78
Title CYP1AI and CYP2E1 gene polymorphisms may increase susceptibility to Oral Submucous Fibrosis among betel quid chewers of Eastern India .
Author Chaudhuri,S.R., Mukherjee,S., Paul,R.R., Haldar,A. and Chaudhuri,K.
Journal Gene 513 (2), 268-271 (2013)
Title The action of cytochrome b(5) on CYP2E1 and CYP2C19 activities requires anionic residues D58 and D65 .
Author Peng,H.M. and Auchus,R.J.
Journal Biochemistry 52 (1), 210-220 (2013)
Title Oxidation of methyl and ethyl nitrosamines by cytochrome P450 2E1 and 2B1 .
Author Chowdhury,G., Calcutt,M.W., Nagy,L.D. and Guengerich,F.P.
Journal Biochemistry 51 (50), 9995-10007 (2012)
Title CYP2E1 RsaI/PstI polymorphism and gastric cancer susceptibility: meta-analyses based on 24 case-control studies .
Author Zhuo,W., Zhang,L., Wang,Y., Ling,J., Zhu,B. and Chen,Z.
Journal PLoS ONE 7 (11), E48265 (2012)
Title CYP2E1 potentiates toxicity in obesity and after chronic ethanol treatment .
Author Cederbaum,A.I.
Journal Drug Metabol Drug Interact 27 (3), 125-144 (2012)
Title Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants .
Author Nelson,D.R., Zeldin,D.C., Hoffman,S.M., Maltais,L.J., Wain,H.M. and Nebert,D.W.
Journal Pharmacogenetics 14 (1), 1-18 (2004)
Title MspI polymorphism of the human CYP2E gene .
Author Uematsu,F., Kikuchi,H., Abe,T., Motomiya,M., Ohmachi,T., Sagami,I. and Watanabe,M.
Journal Nucleic Acids Res. 19 (20), 5797 (1991)
Title Genetic polymorphisms in the 5'-flanking region change transcriptional regulation of the human cytochrome P450IIE1 gene .
Author Hayashi,S., Watanabe,J. and Kawajiri,K.
Journal J. Biochem. 110 (4), 559-565 (1991)
Title Human liver cytochrome P-450 related to a rat acetone-inducible, nitrosamine-metabolizing cytochrome P-450: identification and isolation .
Author Robinson,R.C., Shorr,R.G., Varrichio,A., Park,S.S., Gelboin,H.V., Miller,H. and Friedman,F.K.
Journal Pharmacology 39 (3), 137-144 (1989)
Title Human ethanol-inducible P450IIE1: complete gene sequence, promoter characterization, chromosome mapping, and cDNA-directed expression .
Author Umeno,M., McBride,O.W., Yang,C.S., Gelboin,H.V. and Gonzalez,F.J.
Journal Biochemistry 27 (25), 9006-9013 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878