• THAT   AND
  • THAT   AND


Homo sapiens cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_000773 Homo sapiens cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mRNA. Full Lenth $483.43
ORF Sequence $429.78


RefSeq Version NM_000773.3, 75709190
Length 1667 bp
Structure linear
Update Date 01-MAY-2011
Organism Homo sapiens (human)
Definition Homo sapiens cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mRNA.
Product cytochrome P450 2E1
Comment

Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer. [provided by RefSeq].

RefSeq NP_000764.1
CDS 34..1515
Exon (1)1..210
Exon (2)1..210
Exon (3)211..370
Exon (4)371..520
Exon (5)521..681
Exon (6)682..858
Exon (7)859..1000
Exon (8)1001..1188
Exon (9)1189..1330
Exon (10)1331..1667
Translation MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRL AQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGP TWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVI ADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVA EVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRF ITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK FKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGC IPPRYKLCVIPRS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
1..2+, cdbSNP:11445593
2..3+, cdbSNP:35748520
109+a, gdbSNP:59868347
143..144+, cdbSNP:72559707
143+, c, ct, tdbSNP:72559706
146+c, gdbSNP:76271067
192..193+, cdbSNP:72559709
192+, c, ct, tdbSNP:72559708
207+c, gdbSNP:114535864
226+a, gdbSNP:80297454
240+a, gdbSNP:77188198
247+c, gdbSNP:35844228
260+a, c, gdbSNP:72559710
262+a, gdbSNP:78902616
327+a, gdbSNP:28371740
409+c, tdbSNP:60719153
410+a, gdbSNP:56864127
531+c, tdbSNP:75795289
550+a, gdbSNP:60452492
556+a, gdbSNP:56040284
568+a, gdbSNP:6413419
576+c, gdbSNP:79549556
577+a, gdbSNP:76138620
645+c, tdbSNP:28371743
688+a, gdbSNP:41299426
689+a, gdbSNP:78313785
895+a, gdbSNP:61710826
933+c, gdbSNP:34767794
942+a, cdbSNP:28371746
996+c, tdbSNP:915909
1056+c, gdbSNP:61644766
1130+c, gdbSNP:41299434
1150+a, gdbSNP:59981143
1198+a, gdbSNP:55897648
1214+a, gdbSNP:60207639
1219+c, gdbSNP:59656378
1286+a, gdbSNP:57702102
1296+c, tdbSNP:2515641
1329..1330+, largedeletiondbSNP:71636803
1403+a, tdbSNP:28969387
1484+a, gdbSNP:55982231
1537+c, tdbSNP:7081484
complement(1556)-t, adbSNP:2480257
1560+a, cdbSNP:56307258
complement(1561)-t, cdbSNP:2480256
1567+c, tdbSNP:11101812
1647+a, cdbSNP:12164704
Gene SymbolCYP2E1
Gene SynonymCPE1; CYP2E; P450-J; P450C2E
Chromosome10
Locus Map10q24.3-qter
All Transcripts NM_000773
Title Meta-analyses of the effect of cytochrome P450 2E1 gene polymorphism on the risk of head and neck cancer .
Author Lu,D., Yu,X. and Du,Y.
Journal Mol. Biol. Rep. 38 (4), 2409-2416 (2011)
Title Genetic variation in metabolic genes, occupational solvent exposure, and risk of non-hodgkin lymphoma .
Author Barry,K.H., Zhang,Y., Lan,Q., Zahm,S.H., Holford,T.R., Leaderer,B., Boyle,P., Hosgood,H.D. III, Chanock,S., Yeager,M., Rothman,N. and Zheng,T.
Journal Am. J. Epidemiol. 173 (4), 404-413 (2011)
Title Role of polymorphic N-acetyl transferase2 and cytochrome P4502E1 gene in antituberculosis treatment-induced hepatitis .
Author Bose,P.D., Sarma,M.P., Medhi,S., Das,B.C., Husain,S.A. and Kar,P.
Journal J. Gastroenterol. Hepatol. 26 (2), 312-318 (2011)
Title Flavopiridol pharmacogenetics: clinical and functional evidence for the role of SLCO1B1/OATP1B1 in flavopiridol disposition .
Author Ni,W., Ji,J., Dai,Z., Papp,A., Johnson,A.J., Ahn,S., Farley,K.L., Lin,T.S., Dalton,J.T., Li,X., Jarjoura,D., Byrd,J.C., Sadee,W., Grever,M.R. and Phelps,M.A.
Journal PLoS ONE 5 (11), E13792 (2010)
Title The PstI/RsaI and DraI polymorphisms of CYP2E1 and head and neck cancer risk: a meta-analysis based on 21 case-control studies .
Author Tang,K., Li,Y., Zhang,Z., Gu,Y., Xiong,Y., Feng,G., He,L. and Qin,S.
Journal BMC Cancer 10, 575 (2010)
Title Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants .
Author Nelson,D.R., Zeldin,D.C., Hoffman,S.M., Maltais,L.J., Wain,H.M. and Nebert,D.W.
Journal Pharmacogenetics 14 (1), 1-18 (2004)
Title MspI polymorphism of the human CYP2E gene .
Author Uematsu,F., Kikuchi,H., Abe,T., Motomiya,M., Ohmachi,T., Sagami,I. and Watanabe,M.
Journal Nucleic Acids Res. 19 (20), 5797 (1991)
Title Genetic polymorphisms in the 5'-flanking region change transcriptional regulation of the human cytochrome P450IIE1 gene .
Author Hayashi,S., Watanabe,J. and Kawajiri,K.
Journal J. Biochem. 110 (4), 559-565 (1991)
Title Human liver cytochrome P-450 related to a rat acetone-inducible, nitrosamine-metabolizing cytochrome P-450: identification and isolation .
Author Robinson,R.C., Shorr,R.G., Varrichio,A., Park,S.S., Gelboin,H.V., Miller,H. and Friedman,F.K.
Journal Pharmacology 39 (3), 137-144 (1989)
Title Human ethanol-inducible P450IIE1: complete gene sequence, promoter characterization, chromosome mapping, and cDNA-directed expression .
Author Umeno,M., McBride,O.W., Yang,C.S., Gelboin,H.V. and Gonzalez,F.J.
Journal Biochemistry 27 (25), 9006-9013 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878