• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 (ACE), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000789 Homo sapiens angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 (ACE), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_000789.3, 307691163
Length 4969 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 (ACE), transcript variant 1, mRNA.
Product angiotensin-converting enzyme isoform 1 precursor
Comment

Summary: This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Multiple alternatively spliced transcript variants encoding different isoforms have been identified, and two most abundant spliced variants encode the somatic form and the testicular form, respectively, that are equally active. [provided by RefSeq, May 2010].


Transcript Variant: This variant (1), also known as the endothelial or somatic form, represents the longest transcript and encodes the longest isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000780.1
CDS 35..3955
Misc Feature(1)122..1924
Misc Feature(2)146..1924
Misc Feature(3)179..1876
Misc Feature(4)order(1112..1120,1202..1207,1214..1216,1286..1288,
Misc Feature(5)order(1202..1204,1214..1216,1286..1288)
Misc Feature(6)1925..3730
Misc Feature(7)1934..3718
Misc Feature(8)1988..3670
Misc Feature(9)order(2906..2914,2996..3001,3008..3010,3080..3082,
Misc Feature(10)order(2996..2998,3008..3010,3080..3082)
Misc Feature(11)3530..3532
Misc Feature(12)3707..3709
Misc Feature(13)3728..3730
Misc Feature(14)3803..3865
Misc Feature(15)3929..3931
Exon (1)1..283
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (2)284..451
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (3)452..545
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (4)546..689
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (5)690..881
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (6)882..979
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (7)980..1152
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (8)1153..1376
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (9)1377..1521
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (10)1522..1620
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (11)1621..1743
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (12)1744..1955
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (13)1956..2092
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (14)2093..2251
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (15)2252..2339
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (16)2340..2483
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (17)2484..2675
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (18)2676..2773
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (19)2774..2946
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (20)2947..3170
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (21)3171..3315
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (22)3316..3414
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (23)3415..3537
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (24)3538..3725
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Exon (25)3726..4969
Gene:ACE
Gene Synonym:ACE1; CD143; DCP; DCP1; ICH; MVCD3
Translation MGAASGRRGPGLLLPLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQV LFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPQLRRI IGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASSR SYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDL EHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPF PDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVCH ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRRGANPGFHEAI GDVLALSVSTPEHLHKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS GRTPPSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQF HEALCKEAGYEGPLHQCDIYRSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLL KYFQPVTQWLQEQNQQNGEVLGWPEYQWHPPLPDNYPEGIDLVTDEAEASKFVEEYDRTS QVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRI IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKY EDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLER LFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPS APSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHAS AWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGD VLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGS ITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHE ALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSY FKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQW LLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
31+dbSNP:
31+c, gdbSNP:1110990
79+c, gdbSNP:1110991
211+a, gdbSNP:147912715
265+a, gdbSNP:184457276
287+dbSNP:
287+a, gdbSNP:150382846
383+c, tdbSNP:145692547
445+g, tdbSNP:3729659
473+dbSNP:
473+a, gdbSNP:201716509
477+a, gdbSNP:147057007
488+c, tdbSNP:75214560
491+a, gdbSNP:138437902
492+c, tdbSNP:201277497
494+a, gdbSNP:13306087
499+c, gdbSNP:143320537
508+c, tdbSNP:148351680
511+c, tdbSNP:201285321
513+a, gdbSNP:117134739
530+c, tdbSNP:150908803
537+c, tdbSNP:139076951
546+dbSNP:
546+a, gdbSNP:142380421
571+g, tdbSNP:3730022
576+, gdbSNP:56397451
580+c, tdbSNP:200127371
581+a, gdbSNP:12720754
616+c, tdbSNP:4298
634+a, gdbSNP:4299
639+c, tdbSNP:148460287
666+g, tdbSNP:148144906
674+a, gdbSNP:142677199
688+c, tdbSNP:151017978
713+dbSNP:
713+c, tdbSNP:111998398
716+c, tdbSNP:141543325
749+a, gdbSNP:77294580
765+a, gdbSNP:3730025
778+a, gdbSNP:113540159
792+a, gdbSNP:200907466
812+c, tdbSNP:147670020
813+a, gdbSNP:150011877
814+c, tdbSNP:4302
815+g, tdbSNP:4303
827+c, tdbSNP:138873311
832+c, gdbSNP:121912704
833+a, gdbSNP:149412997
853+c, tdbSNP:148882466
875+c, tdbSNP:138501210
897+dbSNP:
897+a, gdbSNP:199591851
923+a, gdbSNP:61740982
925+a, gdbSNP:145925865
938+g, tdbSNP:139813210
948+a, gdbSNP:141186617
961+c, tdbSNP:150754995
962+a, gdbSNP:144137849
969+c, tdbSNP:201588518
989+dbSNP:
989+a, cdbSNP:34126458
993+c, tdbSNP:139137100
994+a, gdbSNP:149943957
1004+a, gdbSNP:35141294
1009+g, tdbSNP:118145880
1018+a, gdbSNP:192205417
1054+c, tdbSNP:3730026
1055+a, gdbSNP:201456235
1062+a, gdbSNP:200225958
1072+c, gdbSNP:34680431
1086+c, tdbSNP:2229839
1091+a, gdbSNP:148193919
1094+a, gdbSNP:142350301
1112+c, tdbSNP:199690936
1119+c, g, tdbSNP:142328237
1120+a, gdbSNP:151281288
1132+c, tdbSNP:114488574
1153+g, tdbSNP:189243320
1170+a, gdbSNP:13306085
1176+c, tdbSNP:150466411
1209+c, tdbSNP:138418851
1249+c, tdbSNP:4309
1250+a, gdbSNP:201117983
1259+c, tdbSNP:199746395
1263+a, gdbSNP:145172277
1276+c, tdbSNP:138521921
1277+a, gdbSNP:149252911
1293+c, tdbSNP:144494842
1301+a, gdbSNP:148018765
1309+a, gdbSNP:143321044
1317+g, tdbSNP:147180606
1345+c, tdbSNP:144657113
1351+g, tdbSNP:140529617
1352+c, gdbSNP:199697957
1359+c, tdbSNP:35865660
1375+c, gdbSNP:34241302
1382+dbSNP:
1382+a, gdbSNP:185115105
1478+c, tdbSNP:201540553
1483+a, cdbSNP:201780696
1487+c, gdbSNP:202178737
1488+c, gdbSNP:28730839
1493+c, tdbSNP:149784122
1501+c, gdbSNP:145755731
1547+dbSNP:
1547+c, gdbSNP:148943954
1574+a, gdbSNP:201762720
1577+g, tdbSNP:144294634
1605+c, tdbSNP:12720746
1663+dbSNP:
1663+c, tdbSNP:141369597
1681+c, tdbSNP:199955602
1689+a, gdbSNP:145152527
1715+c, tdbSNP:4314
1801+dbSNP:
1801+c, tdbSNP:140086153
1809+a, gdbSNP:12709426
1828+a, gdbSNP:137910205
1879+a, gdbSNP:149476654
1886+a, gdbSNP:111269527
1906+c, tdbSNP:138812566
1914+a, gdbSNP:200963739
1920+a, cdbSNP:201594771
1923+c, tdbSNP:142818229
1945+a, gdbSNP:200255554
1949+a, gdbSNP:72845024
2013+dbSNP:
2013+c, gdbSNP:147429960
2030+a, gdbSNP:201804955
2083+a, cdbSNP:148491967
2101+dbSNP:
2101+a, gdbSNP:141790596
2116+c, gdbSNP:150811476
2189+c, tdbSNP:200649158
2200+c, gdbSNP:188993222
2207+c, gdbSNP:139263584
2220+a, gdbSNP:201527082
2221+a, cdbSNP:35553988
2227+a, gdbSNP:4331
2234+g, tdbSNP:199785479
2291+dbSNP:
2291+a, gdbSNP:140129129
2298+c, tdbSNP:200503880
2310+a, cdbSNP:143843660
2311+g, tdbSNP:199715246
2325+a, tdbSNP:145819052
2333+a, gdbSNP:148995315
2351+dbSNP:
2351+a, gdbSNP:143830698
2360+a, gdbSNP:199869667
2362+a, gdbSNP:4343
2416+a, gdbSNP:61738817
2426+a, gdbSNP:117647476
2443+a, gdbSNP:138771270
2474+c, tdbSNP:142799747
2479+c, tdbSNP:201741777
2488+dbSNP:
2488+c, tdbSNP:146972400
2494+c, tdbSNP:138035588
2506+a, gdbSNP:149528336
2514+c, gdbSNP:200757344
2517+c, tdbSNP:13306091
2521+a, gdbSNP:35580653
2552+a, cdbSNP:3730036
2558+g, tdbSNP:200156271
2584+c, gdbSNP:4975
2604+a, gdbSNP:146089353
2615+c, tdbSNP:140056206
2617+c, tdbSNP:143699430
2626+c, tdbSNP:151293350
2656+c, tdbSNP:139366898
2668+c, gdbSNP:200196657
2714+dbSNP:
2714+a, tdbSNP:150057535
2720+a, gdbSNP:145422285
2781+dbSNP:
2781+c, tdbSNP:3730043
2788+a, gdbSNP:145809210
2821+c, tdbSNP:4348
2825+c, tdbSNP:141180606
2831+c, tdbSNP:200269676
2837+c, tdbSNP:199555061
2860+c, gdbSNP:201517271
2873+a, gdbSNP:201076681
2892+a, gdbSNP:143507892
2908+c, tdbSNP:148024347
2966+dbSNP:
2966+a, gdbSNP:141750591
2986+a, c, gdbSNP:3730044
3013+c, tdbSNP:75067113
3017+c, tdbSNP:141864294
3031+c, tdbSNP:146046369
3060+g, tdbSNP:138825926
3070+c, tdbSNP:147806836
3079+a, tdbSNP:144751624
3087+c, tdbSNP:4976
3101+a, gdbSNP:201529811
3142+a, cdbSNP:142947404
3166+c, tdbSNP:150690061
3167+c, gdbSNP:140980792
3169+a, cdbSNP:200011052
3185+dbSNP:
3185+g, tdbSNP:4977
3197+a, cdbSNP:144926742
3238+c, tdbSNP:189373608
3239+a, gdbSNP:147763588
3252+a, gdbSNP:141139841
3338+dbSNP:
3338+a, cdbSNP:145349565
3355+g, tdbSNP:144974035
3388+c, tdbSNP:192029734
3397+c, tdbSNP:200201337
3400+c, tdbSNP:149084065
3421+dbSNP:
3421+c, tdbSNP:4362
3451+c, tdbSNP:112577612
3464+c, tdbSNP:138675881
3513..3514+, cdbSNP:34743858
3523+c, tdbSNP:4979
3524+a, gdbSNP:145579007
3531+a, gdbSNP:201126192
3541+dbSNP:
3541+c, tdbSNP:202056228
3594+c, tdbSNP:12709442
3595+a, gdbSNP:141429845
3623+a, gdbSNP:201870045
3643+a, gdbSNP:140280723
3663+c, tdbSNP:12720742
3664+a, gdbSNP:138240046
3671+a, gdbSNP:149590791
3679+c, tdbSNP:144312383
3690+c, tdbSNP:140941300
3698+c, tdbSNP:144888208
3700+a, gdbSNP:111576990
3717+c, tdbSNP:121912703
3718+a, gdbSNP:201117207
3794+dbSNP:
3794+c, gdbSNP:56038824
3835+c, tdbSNP:144242912
3870+a, gdbSNP:200754517
3890+a, cdbSNP:4364
3903+a, gdbSNP:12720745
3921+a, cdbSNP:4981
3940+a, gdbSNP:4365
4139+c, tdbSNP:142566653
4231+a, gdbSNP:184388083
4325+c, tdbSNP:151080102
4460+c, gdbSNP:111618613
4541+a, cdbSNP:74979666
4546..4547+, cadbSNP:202110175
4642+c, tdbSNP:146891283
4664+a, gdbSNP:112901380
4682..4683+, ctdbSNP:143875197
4683..4684+, ctdbSNP:68111785
4686..4687+, ctdbSNP:1799763
4727..4728+, cdbSNP:144275717
4849+a, gdbSNP:78716020
4865+a, gdbSNP:1055086
Gene SymbolACE
Gene SynonymACE1; CD143; DCP; DCP1; ICH; MVCD3
Chromosome17
Locus Map17q23.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000789 Homo sapiens angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 (ACE), transcript variant 1, mRNA. On-demand TBD TBD
NM_001178057 Homo sapiens angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 (ACE), transcript variant 3, mRNA. On-demand $849.00 20
NM_152830 Homo sapiens angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 (ACE), transcript variant 2, mRNA. On-demand $849.00 20
Title From an ACE polymorphism to genome-wide searches for eQTL .
Author Soubrier,F.
Journal J. Clin. Invest. 123 (1), 111-112 (2013)
Title G protein beta3 subunit gene C825T and angiotensin converting enzyme gene insertion/deletion polymorphisms in hypertensive Tunisian population .
Author Kabadou,I.A., Soualmia,H., Jemaa,R., Feki,M., Kallel,A., Souheil,O., Taieb,S.H., Sanhaji,H. and Kaabachi,N.
Journal Clin. Lab. 59 (1-2), 85-92 (2013)
Title A direct interaction between DCP1 and XRN1 couples mRNA decapping to 5' exonucleolytic degradation .
Author Braun,J.E., Truffault,V., Boland,A., Huntzinger,E., Chang,C.T., Haas,G., Weichenrieder,O., Coles,M. and Izaurralde,E.
Journal Nat. Struct. Mol. Biol. 19 (12), 1324-1331 (2012)
Title Polymorphisms in angiotensin-converting enzyme and glutathione s-transferase genes in Turkish population and risk for preeclampsia .
Author Atalay,M.A., Ozerkan,K., Karkucak,M., Yakut,T., Atik,Y. and Develioglu,O.H.
Journal Clin Exp Obstet Gynecol 39 (4), 466-469 (2012)
Title ACE/ACE2 ratio and MMP-9 activity as potential biomarkers in tuberculous pleural effusions .
Author Hsieh,W.Y., Kuan,T.C., Cheng,K.S., Liao,Y.C., Chen,M.Y., Lin,P.H., Hsu,Y.C., Huang,C.Y., Hsu,W.H., Yu,S.Y. and Lin,C.S.
Journal Int. J. Biol. Sci. 8 (8), 1197-1205 (2012)
Title Deletion polymorphism in the gene for angiotensin-converting enzyme is a potent risk factor for myocardial infarction .
Author Cambien,F., Poirier,O., Lecerf,L., Evans,A., Cambou,J.P., Arveiler,D., Luc,G., Bard,J.M., Bara,L., Ricard,S. et al.
Journal Nature 359 (6396), 641-644 (1992)
Title The two homologous domains of human angiotensin I-converting enzyme interact differently with competitive inhibitors .
Author Wei,L., Clauser,E., Alhenc-Gelas,F. and Corvol,P.
Journal J. Biol. Chem. 267 (19), 13398-13405 (1992)
Title Absence of linkage between the angiotensin converting enzyme locus and human essential hypertension .
Author Jeunemaitre,X., Lifton,R.P., Hunt,S.C., Williams,R.R. and Lalouel,J.M.
Journal Nat. Genet. 1 (1), 72-75 (1992)
Title Angiotensin-converting enzyme: zinc- and inhibitor-binding stoichiometries of the somatic and testis isozymes .
Author Ehlers,M.R. and Riordan,J.F.
Journal Biochemistry 30 (29), 7118-7126 (1991)
Title Purification and characterization of recombinant human testis angiotensin-converting enzyme expressed in Chinese hamster ovary cells .
Author Ehlers,M.R., Chen,Y.N. and Riordan,J.F.
Journal Protein Expr. Purif. 2 (1), 1-9 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.