• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dopamine receptor D1 (DRD1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23409 Homo sapiens dopamine receptor D1 (DRD1), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu23409C Homo sapiens dopamine receptor D1 (DRD1), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000794.3, 88758587
Length 1341 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens dopamine receptor D1 (DRD1), mRNA.
Product D(1A) dopamine receptor
Comment

Summary: This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events. Alternate transcription initiation sites result in two transcript variants of this gene. [provided by RefSeq, Jul 2008].

RefSeq NP_000785.1
CDS 946..2286
Misc Feature(1)463
Misc Feature(2)463
Misc Feature(3)805..807
Misc Feature(4)1015..1092
Misc Feature(5)1015..1092
Misc Feature(6)1066..>1419
Misc Feature(7)1081..1938
Misc Feature(8)1126..1206
Misc Feature(9)1234..1302
Misc Feature(10)1360..1434
Misc Feature(11)1522..1599
Misc Feature(12)1762..1842
Misc Feature(13)1882..1956
Misc Feature(14)1984..1986
Misc Feature(15)1996..1998
Misc Feature(16)2023..2025
Exon (1)1..462
Gene:DRD1
Gene Synonym:DADR; DRD1A
Exon (2)463..3373
Gene:DRD1
Gene Synonym:DADR; DRD1A
Translation MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL SVILDYDTDVSLEKIQPITQNGQHPT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
16+dbSNP:
16+a, gdbSNP:202230826
complement(77)-g, adbSNP:370393332
complement(109)-t, cdbSNP:10061709
complement(174)-g, adbSNP:189073284
complement(202)-t, cdbSNP:56000379
complement(251)-t, cdbSNP:372160361
complement(262)-g, adbSNP:265981
359+c, tdbSNP:201089398
complement(371)-c, adbSNP:11742764
complement(640)-t, cdbSNP:185064274
complement(690)-t, cdbSNP:111805057
complement(730)-t, adbSNP:371698970
complement(783)-g, adbSNP:192224189
complement(842)-t, gdbSNP:79985405
852+a, gdbSNP:5326
complement(898)-t, cdbSNP:4532
complement(924)-t, adbSNP:187630543
complement(927)-t, adbSNP:369445409
complement(976)-t, cdbSNP:146816422
complement(984)-t, cdbSNP:369853177
complement(1008)-c, adbSNP:145032403
1035+a, gdbSNP:1042768
1054..1055+a, c, gdbSNP:5327
complement(1056)-c, adbSNP:372040450
complement(1074)-c, adbSNP:369288437
1086+a, c, gdbSNP:5329
1095+g, tdbSNP:5330
complement(1140)-g, adbSNP:141052935
1143+a, gdbSNP:1799914
1167+a, c, tdbSNP:1042770
complement(1168)-t, cdbSNP:367761486
complement(1299)-g, adbSNP:191953032
complement(1326)-g, adbSNP:149673312
complement(1362)-t, gdbSNP:374437918
complement(1366)-g, adbSNP:372262906
complement(1377)-g, adbSNP:116072750
complement(1384)-t, cdbSNP:368319023
complement(1497)-g, adbSNP:148899064
complement(1500)-t, gdbSNP:187573912
complement(1507)-t, adbSNP:374427471
complement(1509)-g, adbSNP:148681593
complement(1510)-t, adbSNP:113146177
1540+g, tdbSNP:5331
complement(1540)-c, adbSNP:386598368
complement(1545)-t, cdbSNP:145599956
complement(1578)-g, adbSNP:200975855
complement(1629)-g, adbSNP:144226767
1630+a, gdbSNP:13306309
complement(1646)-g, adbSNP:140250188
complement(1693)-g, adbSNP:200037245
complement(1698)-g, cdbSNP:147169569
complement(1712)-g, adbSNP:182894202
1721+a, cdbSNP:74414188
complement(1753)-g, cdbSNP:139908345
complement(1770)-t, cdbSNP:201944827
complement(1836)-g, adbSNP:370118588
complement(1843)-g, adbSNP:191808405
complement(1860)-g, adbSNP:377005366
complement(1861)-g, adbSNP:150662348
complement(1887)-g, adbSNP:373400500
complement(1929)-g, adbSNP:141925440
1989+c, tdbSNP:6272
complement(1992)-t, adbSNP:370098478
complement(2003)-g, adbSNP:144813919
complement(2049)-g, adbSNP:373118849
complement(2051)-g, adbSNP:201076076
complement(2052)-t, cdbSNP:374239045
complement(2139)-g, adbSNP:141964738
complement(2172)-g, adbSNP:187504751
complement(2173)-t, cdbSNP:201057716
complement(2205)-t, cdbSNP:199860205
complement(2208)-t, cdbSNP:155417
complement(2232)-g, adbSNP:200809329
complement(2233)-t, cdbSNP:145080397
complement(2262)-t, cdbSNP:202050642
complement(2273)-t, cdbSNP:62636575
complement(2282)-g, adbSNP:182759154
complement(2290)-g, adbSNP:375177269
2297+a, gdbSNP:5332
complement(2297)-g, adbSNP:386598371
complement(2320)-g, adbSNP:368890959
complement(2348)-g, adbSNP:686
2349+c, tdbSNP:1799961
complement(2430)-g, adbSNP:41275335
complement(2500)-t, cdbSNP:144821512
complement(2505)-c, adbSNP:371818668
2512+c, tdbSNP:140926690
complement(2566)-c, adbSNP:368180983
complement(2630)-, cdbSNP:142247949
complement(2714)-t, gdbSNP:190425059
complement(2903)-g, adbSNP:200058591
complement(2918)-g, adbSNP:62388319
complement(2976..2977)-, agdbSNP:148869003
complement(3097)-t, adbSNP:372631082
complement(3149)-t, cdbSNP:4867798
complement(3178)-t, cdbSNP:147261878
complement(3299)-g, adbSNP:116555419
Gene SymbolDRD1
Gene SynonymDADR; DRD1A
Chromosome5
Locus Map5q35.1
Title Nonlinear dose-dependent impact of D1 receptor activation on motor cortex plasticity in humans .
Author Fresnoza S, Paulus W, Nitsche MA and Kuo MF.
Journal J. Neurosci. 34 (7), 2744-2753 (2014)
Title Cytosolic sulfotransferase 1A3 is induced by dopamine and protects neuronal cells from dopamine toxicity: role of D1 receptor-N-methyl-D-aspartate receptor coupling .
Author Sidharthan NP, Minchin RF and Butcher NJ.
Journal J. Biol. Chem. 288 (48), 34364-34374 (2013)
Title HIV-related cognitive impairment shows bi-directional association with dopamine receptor DRD1 and DRD2 polymorphisms in substance-dependent and substance-independent populations .
Author Jacobs,M.M., Murray,J., Byrd,D.A., Hurd,Y.L. and Morgello,S.
Journal J. Neurovirol. 19 (5), 495-504 (2013)
Title Dopamine D1 receptor gene variation modulates opioid dependence risk by affecting transition to addiction .
Author Zhu F, Yan CX, Wen YC, Wang J, Bi J, Zhao YL, Wei L, Gao CG, Jia W and Li SB.
Journal PLoS ONE 8 (8), E70805 (2013)
Title Dopamine receptors and the pharmacogenetics of side-effects of stimulant treatment for attention-deficit/hyperactivity disorder .
Author Levy,F., Wimalaweera,S., Moul,C., Brennan,J. and Dadds,M.R.
Journal J Child Adolesc Psychopharmacol 23 (6), 423-425 (2013)
Title Cholera toxin-sensitive 3',5'-cyclic adenosine monophosphate and calcium signals of the human dopamine-D1 receptor: selective potentiation by protein kinase A .
Author Liu YF, Civelli O, Zhou QY and Albert PR.
Journal Mol. Endocrinol. 6 (11), 1815-1824 (1992)
Title Characterization of the 5' flanking region of the human D1A dopamine receptor gene .
Author Minowa MT, Minowa T, Monsma FJ Jr, Sibley DR and Mouradian MM.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (7), 3045-3049 (1992)
Title Cloning, molecular characterization, and chromosomal assignment of a gene encoding a second D1 dopamine receptor subtype: differential expression pattern in rat brain compared with the D1A receptor .
Author Tiberi M, Jarvie KR, Silvia C, Falardeau P, Gingrich JA, Godinot N, Bertrand L, Yang-Feng TL, Fremeau RT Jr and Caron MG.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (17), 7491-7495 (1991)
Title A human D1 dopamine receptor gene is located on chromosome 5 at q35.1 and identifies an EcoRI RFLP .
Author Grandy DK, Zhou QY, Allen L, Litt R, Magenis RE, Civelli O and Litt M.
Journal Am. J. Hum. Genet. 47 (5), 828-834 (1990)
Title Human dopamine D1 receptor encoded by an intronless gene on chromosome 5 .
Author Sunahara RK, Niznik HB, Weiner DM, Stormann TM, Brann MR, Kennedy JL, Gelernter JE, Rozmahel R, Yang YL and Israel Y.
Journal Nature 347 (6288), 80-83 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.