• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dopamine receptor D1 (DRD1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000794 Homo sapiens dopamine receptor D1 (DRD1), mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_000794.3, 88758587
Length 3373 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens dopamine receptor D1 (DRD1), mRNA.
Product D(1A) dopamine receptor
Comment

Summary: This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events. Alternate transcription initiation sites result in two transcript variants of this gene. [provided by RefSeq, Jul 2008].

RefSeq NP_000785.1
CDS 946..2286
Misc Feature(1)463
Misc Feature(2)463
Misc Feature(3)805..807
Misc Feature(4)1015..1092
Misc Feature(5)1015..1092
Misc Feature(6)1081..1938
Misc Feature(7)1126..1206
Misc Feature(8)1234..1302
Misc Feature(9)<1261..>1419
Misc Feature(10)1360..1434
Misc Feature(11)1522..1599
Misc Feature(12)1762..1842
Misc Feature(13)1882..1956
Misc Feature(14)1984..1986
Misc Feature(15)1996..1998
Misc Feature(16)2023..2025
Exon (1)1..462
Gene:DRD1
Gene Synonym:DADR; DRD1A
Exon (2)463..3373
Gene:DRD1
Gene Synonym:DADR; DRD1A
Translation MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL SVILDYDTDVSLEKIQPITQNGQHPT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(16)-dbSNP:
complement(16)-g, adbSNP:202230826
complement(109)-t, cdbSNP:10061709
complement(174)-g, adbSNP:189073284
complement(202)-t, cdbSNP:56000379
complement(262)-g, adbSNP:265981
complement(359)-t, cdbSNP:201089398
complement(371)-c, adbSNP:11742764
complement(640)-t, cdbSNP:185064274
complement(690)-t, cdbSNP:111805057
complement(783)-g, adbSNP:192224189
complement(842)-t, gdbSNP:79985405
complement(852)-g, adbSNP:5326
complement(898)-t, cdbSNP:4532
complement(924)-t, adbSNP:187630543
complement(976)-t, cdbSNP:146816422
complement(1008)-c, adbSNP:145032403
complement(1035)-g, adbSNP:1042768
complement(1054)-c, adbSNP:5327
complement(1055)-g, cdbSNP:5328
complement(1086)-g, c, adbSNP:5329
complement(1095)-t, gdbSNP:5330
complement(1140)-g, adbSNP:141052935
complement(1143)-g, adbSNP:1799914
complement(1167)-c, adbSNP:1042770
complement(1299)-g, adbSNP:191953032
complement(1326)-g, adbSNP:149673312
complement(1377)-g, adbSNP:116072750
complement(1497)-g, adbSNP:148899064
complement(1500)-t, gdbSNP:187573912
complement(1509)-g, adbSNP:148681593
complement(1510)-t, adbSNP:113146177
complement(1540)-t, gdbSNP:5331
complement(1545)-t, cdbSNP:145599956
complement(1578)-g, adbSNP:200975855
complement(1629)-g, adbSNP:144226767
complement(1630)-g, adbSNP:13306309
complement(1646)-g, adbSNP:140250188
complement(1693)-g, adbSNP:200037245
complement(1698)-g, cdbSNP:147169569
complement(1712)-g, adbSNP:182894202
complement(1721)-c, adbSNP:74414188
complement(1753)-g, cdbSNP:139908345
complement(1770)-t, cdbSNP:201944827
complement(1843)-g, adbSNP:191808405
complement(1861)-g, adbSNP:150662348
complement(1929)-g, adbSNP:141925440
complement(1989)-t, cdbSNP:6272
complement(2003)-g, adbSNP:144813919
complement(2051)-g, adbSNP:201076076
complement(2139)-g, adbSNP:141964738
complement(2172)-g, adbSNP:187504751
complement(2173)-t, cdbSNP:201057716
complement(2205)-t, cdbSNP:199860205
complement(2208)-t, cdbSNP:155417
complement(2232)-g, adbSNP:200809329
complement(2233)-t, cdbSNP:145080397
complement(2262)-t, cdbSNP:202050642
complement(2273)-t, cdbSNP:62636575
complement(2282)-g, adbSNP:182759154
complement(2297)-g, adbSNP:5332
complement(2348)-g, adbSNP:686
complement(2349)-t, cdbSNP:1799961
complement(2430)-g, adbSNP:41275335
complement(2500)-t, cdbSNP:144821512
complement(2512)-t, cdbSNP:140926690
complement(2630)-, cdbSNP:142247949
complement(2714)-t, gdbSNP:190425059
complement(2903)-g, adbSNP:200058591
complement(2918)-g, adbSNP:62388319
complement(2976..2977)-, agdbSNP:148869003
complement(3149)-t, cdbSNP:4867798
complement(3178)-t, cdbSNP:147261878
complement(3299)-g, adbSNP:116555419
Gene SymbolDRD1
Gene SynonymDADR; DRD1A
Chromosome5
Locus Map5q35.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000794 Homo sapiens dopamine receptor D1 (DRD1), mRNA. In-stock $509.00 $460.00 12
Title Calcyon forms a novel ternary complex with dopamine D1 receptor through PSD-95 protein and plays a role in dopamine receptor internalization .
Author Ha,C.M., Park,D., Han,J.K., Jang,J.I., Park,J.Y., Hwang,E.M., Seok,H. and Chang,S.
Journal J. Biol. Chem. 287 (38), 31813-31822 (2012)
Title Dopamine and angiotensin type 2 receptors cooperatively inhibit sodium transport in human renal proximal tubule cells .
Author Gildea,J.J., Wang,X., Shah,N., Tran,H., Spinosa,M., Van Sciver,R., Sasaki,M., Yatabe,J., Carey,R.M., Jose,P.A. and Felder,R.A.
Journal Hypertension 60 (2), 396-403 (2012)
Title A comparison of striatal-dependent behaviors in wild-type and hemizygous Drd1a and Drd2 BAC transgenic mice .
Author Nelson,A.B., Hang,G.B., Grueter,B.A., Pascoli,V., Luscher,C., Malenka,R.C. and Kreitzer,A.C.
Journal J. Neurosci. 32 (27), 9119-9123 (2012)
Title DRD1 associations with smoking abstinence across slow and normal nicotine metabolizers .
Author Lee,W., Ray,R., Bergen,A.W., Swan,G.E., Thomas,P., Tyndale,R.F., Benowitz,N.L., Lerman,C. and Conti,D.V.
Journal Pharmacogenet. Genomics 22 (7), 551-554 (2012)
Title Aging-related increases in behavioral variability: relations to losses of dopamine D1 receptors .
Author MacDonald,S.W., Karlsson,S., Rieckmann,A., Nyberg,L. and Backman,L.
Journal J. Neurosci. 32 (24), 8186-8191 (2012)
Title Cholera toxin-sensitive 3',5'-cyclic adenosine monophosphate and calcium signals of the human dopamine-D1 receptor: selective potentiation by protein kinase A .
Author Liu,Y.F., Civelli,O., Zhou,Q.Y. and Albert,P.R.
Journal Mol. Endocrinol. 6 (11), 1815-1824 (1992)
Title Characterization of the 5' flanking region of the human D1A dopamine receptor gene .
Author Minowa,M.T., Minowa,T., Monsma,F.J. Jr., Sibley,D.R. and Mouradian,M.M.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (7), 3045-3049 (1992)
Title Cloning, molecular characterization, and chromosomal assignment of a gene encoding a second D1 dopamine receptor subtype: differential expression pattern in rat brain compared with the D1A receptor .
Author Tiberi,M., Jarvie,K.R., Silvia,C., Falardeau,P., Gingrich,J.A., Godinot,N., Bertrand,L., Yang-Feng,T.L., Fremeau,R.T. Jr. and Caron,M.G.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (17), 7491-7495 (1991)
Title A human D1 dopamine receptor gene is located on chromosome 5 at q35.1 and identifies an EcoRI RFLP .
Author Grandy,D.K., Zhou,Q.Y., Allen,L., Litt,R., Magenis,R.E., Civelli,O. and Litt,M.
Journal Am. J. Hum. Genet. 47 (5), 828-834 (1990)
Title Human dopamine D1 receptor encoded by an intronless gene on chromosome 5 .
Author Sunahara,R.K., Niznik,H.B., Weiner,D.M., Stormann,T.M., Brann,M.R., Kennedy,J.L., Gelernter,J.E., Rozmahel,R., Yang,Y.L., Israel,Y. et al.
Journal Nature 347 (6288), 80-83 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.