• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dopamine receptor D2 (DRD2), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000795 Homo sapiens dopamine receptor D2 (DRD2), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_000795.3, 181336946
Length 2713 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens dopamine receptor D2 (DRD2), transcript variant 1, mRNA.
Product D(2) dopamine receptor isoform long
Comment

Summary: This gene encodes the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative splicing of this gene results in two transcript variants encoding different isoforms. A third variant has been described, but it has not been determined whether this form is normal or due to aberrant splicing. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longer isoform (long).

RefSeq NP_000786.1
CDS 236..1567
Misc Feature(1)200..202
Misc Feature(2)347..415
Misc Feature(3)347..415
Misc Feature(4)404..>796
Misc Feature(5)446..514
Misc Feature(6)order(554..556,779..781)
Misc Feature(7)560..625
Misc Feature(8)<593..>760
Misc Feature(9)689..751
Misc Feature(10)800..874
Misc Feature(11)803..826
Misc Feature(12)815..817
Misc Feature(13)824..826
Misc Feature(14)866..1354
Misc Feature(15)1355..1420
Misc Feature(16)1391..1417
Misc Feature(17)1463..1528
Exon (1)1..204
Gene:DRD2
Gene Synonym:D2DR; D2R
Exon (2)205..520
Gene:DRD2
Gene Synonym:D2DR; D2R
Exon (3)521..630
Gene:DRD2
Gene Synonym:D2DR; D2R
Exon (4)631..767
Gene:DRD2
Gene Synonym:D2DR; D2R
Exon (5)768..958
Gene:DRD2
Gene Synonym:D2DR; D2R
Exon (6)959..1045
Gene:DRD2
Gene Synonym:D2DR; D2R
Exon (7)1046..1373
Gene:DRD2
Gene Synonym:D2DR; D2R
Exon (8)1374..2699
Gene:DRD2
Gene Synonym:D2DR; D2R
Translation MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(15)-dbSNP:
complement(15)-c, adbSNP:12281924
complement(184)-g, cdbSNP:7116768
complement(232)-dbSNP:
complement(232)-g, adbSNP:200715742
complement(293)-g, adbSNP:149874318
complement(294)-t, cdbSNP:199932425
complement(295)-g, adbSNP:4986923
complement(304)-g, adbSNP:200831689
complement(313)-g, adbSNP:200272626
complement(314)-t, cdbSNP:201424743
complement(318)-t, cdbSNP:200802757
complement(322)-t, cdbSNP:199524272
complement(330)-g, cdbSNP:201238984
complement(352)-t, cdbSNP:146219910
complement(367)-t, cdbSNP:4986918
complement(370)-g, adbSNP:201795635
complement(372)-g, adbSNP:201061220
complement(379)-t, cdbSNP:75275037
complement(380)-t, cdbSNP:139923738
complement(388)-c, adbSNP:80030508
complement(391)-g, adbSNP:201114741
complement(392)-t, cdbSNP:200010436
complement(418)-t, g, adbSNP:201945675
complement(426)-g, adbSNP:201137518
complement(434)-t, adbSNP:201057025
complement(463)-g, adbSNP:200084134
complement(466)-t, cdbSNP:202172997
complement(484)-g, adbSNP:201736234
complement(485)-t, cdbSNP:199961459
complement(530)-t, cdbSNP:199765712
complement(565)-g, adbSNP:201130366
complement(577)-g, adbSNP:200402411
complement(592)-t, cdbSNP:141811103
complement(594)-g, c, adbSNP:201724929
complement(595)-t, cdbSNP:199754592
complement(613)-c, adbSNP:148478679
complement(658)-dbSNP:
complement(658)-g, adbSNP:1800499
complement(661)-t, cdbSNP:71653612
complement(667)-t, cdbSNP:201471837
complement(669)-t, cdbSNP:200486137
complement(684)-t, cdbSNP:199517364
complement(688)-t, g, cdbSNP:199549160
complement(694)-g, adbSNP:202047707
complement(695)-g, adbSNP:104894220
complement(707)-t, cdbSNP:139000780
complement(728)-t, cdbSNP:199577077
complement(751)-g, adbSNP:147347002
complement(769)-dbSNP:
complement(769)-g, adbSNP:143890565
complement(775)-g, adbSNP:200496289
complement(814)-g, adbSNP:202200970
complement(833)-t, c, adbSNP:138509142
complement(853)-c, adbSNP:147086003
complement(891)-t, cdbSNP:200148328
complement(898)-t, cdbSNP:140638952
complement(909)-g, adbSNP:151320768
complement(914)-g, cdbSNP:201881891
complement(924)-t, cdbSNP:200419139
complement(925)-t, adbSNP:199961951
complement(946)-t, cdbSNP:201628301
complement(952)-t, cdbSNP:201004067
complement(976)-dbSNP:
complement(976)-t, g, cdbSNP:80350280
complement(977)-t, cdbSNP:201628227
complement(1001)-t, cdbSNP:148827819
complement(1007)-t, gdbSNP:201649606
complement(1026)-g, cdbSNP:200966282
complement(1041)-t, cdbSNP:146652676
complement(1056)-dbSNP:
complement(1056)-t, cdbSNP:200184730
complement(1067)-g, adbSNP:75673283
complement(1087)-t, cdbSNP:4986921
complement(1104)-g, cdbSNP:201131985
complement(1105)-g, c, adbSNP:74548208
complement(1119)-t, adbSNP:199926793
complement(1123)-g, adbSNP:201676705
complement(1157)-g, adbSNP:200829286
complement(1159)-g, adbSNP:146497846
complement(1160)-t, cdbSNP:149926361
complement(1163)-t, cdbSNP:1800496
complement(1165)-t, cdbSNP:201422791
complement(1167)-g, cdbSNP:1801028
complement(1174)-t, cdbSNP:6275
complement(1177)-g, adbSNP:140719436
complement(1192)-t, cdbSNP:6277
complement(1201)-g, adbSNP:143935143
complement(1214)-g, adbSNP:71653614
complement(1227)-g, adbSNP:202088196
complement(1245)-t, cdbSNP:78973299
complement(1255)-g, cdbSNP:201256011
complement(1274)-g, adbSNP:200340299
complement(1275)-g, adbSNP:144999500
complement(1278)-t, cdbSNP:143779712
complement(1286)-g, adbSNP:1110977
complement(1294)-g, cdbSNP:199840213
complement(1297)-g, adbSNP:149410294
complement(1305)-g, adbSNP:202098964
complement(1313)-g, adbSNP:201230093
complement(1314)-t, cdbSNP:138873192
complement(1322)-t, gdbSNP:201735014
complement(1361)-t, cdbSNP:200890663
complement(1375)-dbSNP:
complement(1375)-g, adbSNP:201123323
complement(1376)-t, cdbSNP:200352240
complement(1381)-g, adbSNP:199514519
complement(1411)-t, cdbSNP:201537500
complement(1447)-t, cdbSNP:200532405
complement(1469)-t, cdbSNP:150273300
complement(1471)-g, adbSNP:71653615
complement(1492)-t, cdbSNP:79932566
complement(1495)-g, adbSNP:200440686
complement(1498)-t, cdbSNP:202151925
complement(1513)-g, adbSNP:201093886
complement(1540)-g, adbSNP:77930100
complement(1559)-g, adbSNP:201801648
complement(1563)-c, adbSNP:140938110
complement(1572)-t, cdbSNP:201275953
complement(1574)-t, g, cdbSNP:79266662
complement(1582)-g, adbSNP:201621795
complement(1583)-t, cdbSNP:199523375
complement(1587)-t, cdbSNP:199542111
complement(1604)-c, adbSNP:9282673
complement(1613)-g, adbSNP:200858680
complement(1619)-g, adbSNP:6276
complement(1636)-t, g, adbSNP:201475538
complement(1637)-t, cdbSNP:200559334
complement(1640)-g, cdbSNP:199729096
complement(1641)-g, adbSNP:201423084
complement(1642)-t, cdbSNP:200266844
complement(1658)-g, adbSNP:9282672
complement(1663)-t, cdbSNP:201535094
complement(1667)-t, c, adbSNP:145419243
complement(1673)-g, adbSNP:202032930
complement(1677)-g, adbSNP:201110531
complement(1684)-t, cdbSNP:200147005
complement(1697)-g, cdbSNP:201877566
complement(1703)-t, cdbSNP:200902658
complement(1710)-g, adbSNP:199960714
complement(1716)-t, gdbSNP:201395618
complement(1728)-g, adbSNP:200907369
complement(1729)-t, cdbSNP:200094288
complement(1732)-g, adbSNP:201700158
complement(1738)-g, adbSNP:200800208
complement(1750)-t, cdbSNP:199530432
complement(1752)-t, cdbSNP:201483491
complement(1799)-t, adbSNP:200698836
complement(1822)-t, gdbSNP:199666125
complement(1887)-g, adbSNP:201468109
complement(1893)-t, cdbSNP:200553439
complement(1896)-c, adbSNP:202216753
complement(1902)-c, adbSNP:201476947
complement(1905)-c, adbSNP:200255258
complement(1910)-t, gdbSNP:111514221
complement(1912)-g, adbSNP:200963966
complement(1943)-g, cdbSNP:6279
complement(1945)-g, adbSNP:202029659
complement(1969)-t, g, adbSNP:201101625
complement(1970)-t, cdbSNP:199842575
complement(1983)-t, cdbSNP:202048283
complement(1987)-t, gdbSNP:200744960
complement(1995)-t, gdbSNP:199924485
complement(2012)-t, cdbSNP:201675047
complement(2064)-t, gdbSNP:200824645
complement(2082)-t, adbSNP:199733203
complement(2088)-t, gdbSNP:6274
complement(2096)-g, cdbSNP:1130354
complement(2127)-g, adbSNP:200800026
complement(2131)-g, adbSNP:199516692
complement(2132)-t, cdbSNP:190267578
complement(2135)-t, gdbSNP:200282737
complement(2139)-t, cdbSNP:199695073
complement(2144)-c, adbSNP:201058855
complement(2157)-g, adbSNP:113184960
complement(2161)-c, adbSNP:202236974
complement(2168)-g, adbSNP:184532204
complement(2169)-t, g, cdbSNP:200380382
complement(2184)-g, adbSNP:201931076
complement(2187)-c, adbSNP:201229921
complement(2189)-g, adbSNP:200074947
complement(2197)-g, adbSNP:201729901
complement(2211)-t, cdbSNP:200889099
complement(2252)-g, cdbSNP:199837640
complement(2253)-g, cdbSNP:202046871
complement(2259)-g, adbSNP:200736433
complement(2270)-t, adbSNP:199574690
complement(2271)-g, adbSNP:201648344
complement(2283)-g, cdbSNP:200708514
complement(2288)-g, adbSNP:199758344
complement(2292)-t, gdbSNP:6278
complement(2304)-g, adbSNP:141843081
complement(2305)-t, cdbSNP:199512742
complement(2329)-g, adbSNP:115186256
complement(2344)-t, cdbSNP:200494127
complement(2365)-g, cdbSNP:74786742
complement(2402)-t, cdbSNP:200898113
complement(2404)-g, adbSNP:200439184
complement(2442)-t, adbSNP:202150911
complement(2445)-g, adbSNP:201091901
complement(2454)-t, adbSNP:61905361
complement(2455)-g, adbSNP:199985520
complement(2458)-c, adbSNP:201625222
complement(2469)-c, adbSNP:192448487
complement(2493)-t, g, adbSNP:6273
complement(2516)-g, adbSNP:200080912
complement(2534)-g, adbSNP:201464003
complement(2536)-t, cdbSNP:200557458
complement(2637)-g, adbSNP:199536089
complement(2648)-t, cdbSNP:201583983
complement(2658)-t, g, cdbSNP:200733424
complement(2669)-c, adbSNP:199660782
complement(2674)-t, cdbSNP:114851076
complement(2696)-t, cdbSNP:200982455
Gene SymbolDRD2
Gene SynonymD2DR; D2R
Chromosome11
Locus Map11q23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000795 Homo sapiens dopamine receptor D2 (DRD2), transcript variant 1, mRNA. In-stock $509.00 $460.00 12
NM_016574 Homo sapiens dopamine receptor D2 (DRD2), transcript variant 2, mRNA. In-stock $418.00 $369.00 10
Title BDNF Val66Met and DRD2 Taq1A polymorphisms interact to influence .
Author Hemmings,S.M., Martin,L.I., Klopper,M., van der Merwe,L., Aitken,L., de Wit,E., Black,G.F., Hoal,E.G., Walzl,G. and Seedat,S.
Journal Prog. Neuropsychopharmacol. Biol. Psychiatry 40, 273-280 (2013)
Title Association study of DRD2 and MAOA genes with subtyped alcoholism comorbid with bipolar disorder in Han Chinese .
Author Hu,M.C., Lee,S.Y., Wang,T.Y., Chen,S.L., Chang,Y.H., Chen,S.H., Chu,C.H., Wang,C.L., Lee,I.H., Yeh,T.L., Yang,Y.K. and Lu,R.B.
Journal Prog. Neuropsychopharmacol. Biol. Psychiatry 40, 144-148 (2013)
Title Evocative gene-parenting correlations and academic performance at first grade: an exploratory study .
Author Propper,C.B., Shanahan,M.J., Russo,R. and Mills-Koonce,W.R.
Journal Dev. Psychopathol. 24 (4), 1265-1282 (2012)
Title Pharmacogenomic associations with weight gain in olanzapine treatment of patients without schizophrenia .
Author Houston,J.P., Kohler,J., Bishop,J.R., Ellingrod,V.L., Ostbye,K.M., Zhao,F., Conley,R.R., Poole Hoffmann,V. and Fijal,B.A.
Journal J Clin Psychiatry 73 (8), 1077-1086 (2012)
Title Custom genotyping for substance addiction susceptibility genes in Jordanians of Arab descent .
Author Al-Eitan,L.N., Jaradat,S.A., Hulse,G.K. and Tay,G.K.
Journal BMC Res Notes 5, 497 (2012)
Title Structure and linkage of the D2 dopamine receptor and neural cell adhesion molecule genes on human chromosome 11q23 .
Author Eubanks,J.H., Djabali,M., Selleri,L., Grandy,D.K., Civelli,O., McElligott,D.L. and Evans,G.A.
Journal Genomics 14 (4), 1010-1018 (1992)
Title Differential sensitivity of the short and long human dopamine D2 receptor subtypes to protein kinase C .
Author Liu,Y.F., Civelli,O., Grandy,D.K. and Albert,P.R.
Journal J. Neurochem. 59 (6), 2311-2317 (1992)
Title Structure and expression of human and rat D2 dopamine receptor genes .
Author Araki,K., Kuwano,R., Morii,K., Hayashi,S., Minoshima,S., Shimizu,N., Katagiri,T., Usui,H., Kumanishi,T. and Takahashi,Y.
Journal Neurochem. Int. 21 (1), 91-98 (1992)
Title D2 dopamine receptors in the human retina: cloning of cDNA and localization of mRNA .
Author Dearry,A., Falardeau,P., Shores,C. and Caron,M.G.
Journal Cell. Mol. Neurobiol. 11 (5), 437-453 (1991)
Title Direct sequencing of the dopamine D2 receptor (DRD2) in schizophrenics reveals three polymorphisms but no structural change in the receptor .
Author Sarkar,G., Kapelner,S., Grandy,D.K., Marchionni,M., Civelli,O., Sobell,J., Heston,L. and Sommer,S.S.
Journal Genomics 11 (1), 8-14 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.