• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dopamine receptor D4 (DRD4), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000797 Homo sapiens dopamine receptor D4 (DRD4), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_000797.3, 296010830
Length 1378 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens dopamine receptor D4 (DRD4), mRNA.
Product D(4) dopamine receptor
Comment

Summary: This gene encodes the D4 subtype of the dopamine receptor. The D4 subtype is a G-protein coupled receptor which inhibits adenylyl cyclase. It is a target for drugs which treat schizophrenia and Parkinson disease. Mutations in this gene have been associated with various behavioral phenotypes, including autonomic nervous system dysfunction, attention deficit/hyperactivity disorder, and the personality trait of novelty seeking. This gene contains a polymorphic number (2-10 copies) of tandem 48 nt repeats; the sequence shown contains four repeats. [provided by RefSeq, Jul 2008].

RefSeq NP_000788.2
CDS 1..1260
Misc Feature(1)169..1200
Misc Feature(2)169..1200
Exon (1)286..398
Gene:DRD4
Gene Synonym:D4DR
Exon (2)399..1057
Gene:DRD4
Gene Synonym:D4DR
Exon (3)1058..1363
Gene:DRD4
Gene Synonym:D4DR
Translation MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPSLPQDPCGPDCAPPAPG LPPDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWT PFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
30+dbSNP:
30+c, gdbSNP:12720386
31+c, gdbSNP:189482961
112+c, gdbSNP:76423882
118+g, tdbSNP:369168581
139+a, gdbSNP:374359731
147+c, tdbSNP:192669730
149+a, cdbSNP:185063439
171+c, gdbSNP:201211288
189+c, tdbSNP:141565361
198+a, gdbSNP:146404200
220+a, gdbSNP:199876324
222+a, gdbSNP:139480839
231+a, gdbSNP:144215684
232+a, gdbSNP:146562378
234+c, tdbSNP:370549757
235+g, tdbSNP:139782868
249+c, tdbSNP:149808759
250+a, gdbSNP:145562859
277+c, tdbSNP:148883863
328+dbSNP:
328+a, gdbSNP:143594804
334+a, cdbSNP:372161190
341+c, tdbSNP:375611171
369+c, tdbSNP:147645347
378+c, gdbSNP:369672484
380+a, gdbSNP:199795245
468+dbSNP:
468+c, tdbSNP:376775543
494..495+, ggggggdbSNP:143897291
501+a, gdbSNP:372617537
508+a, gdbSNP:375642150
526+g, tdbSNP:371074760
546+c, tdbSNP:373806229
558+c, tdbSNP:374753202
581+g, tdbSNP:1800443
602+c, tdbSNP:199609858
603+c, tdbSNP:199869206
617+a, cdbSNP:145777890
635+a, gdbSNP:201764493
648+c, tdbSNP:200515603
662+a, gdbSNP:138691183
663+c, gdbSNP:141203143
679+c, tdbSNP:370595201
680+a, gdbSNP:150331478
683+c, tdbSNP:138885045
690+g, tdbSNP:374957955
694+a, gdbSNP:367612113
841+c, gdbSNP:3889692
850+a, gdbSNP:34662058
870+c, tdbSNP:762502
938+c, gdbSNP:200686422
994+a, cdbSNP:372805272
1004+c, gdbSNP:200996360
1005+c, gdbSNP:12720410
1016+a, gdbSNP:199815231
1032+c, tdbSNP:200069417
1056+c, gdbSNP:201878429
1068+dbSNP:
1068+c, gdbSNP:199628904
1074+c, gdbSNP:201886833
1075+g, tdbSNP:200086731
1089+c, tdbSNP:936463
1107+a, gdbSNP:34773603
1129+c, gdbSNP:374911834
1146+c, tdbSNP:370350460
1153+a, gdbSNP:201770727
1154+c, tdbSNP:149408856
1159+g, tdbSNP:74991942
1191+c, tdbSNP:139758515
1194+c, tdbSNP:373242165
1218+c, gdbSNP:142719624
1222+c, tdbSNP:377281442
1233+c, tdbSNP:370568420
1234+c, gdbSNP:373483649
1235+g, tdbSNP:115232659
1246+c, tdbSNP:184197348
1247+c, gdbSNP:377409215
1259+a, gdbSNP:370427849
1263+c, gdbSNP:369869458
1264+a, gdbSNP:201902931
1273+c, tdbSNP:377630101
1274+a, gdbSNP:370728840
1306+a, gdbSNP:371239424
1327+c, tdbSNP:368470740
1337+c, gdbSNP:116247796
1360+c, g, tdbSNP:375367029
Gene SymbolDRD4
Gene SynonymD4DR
Chromosome11
Locus Map11p15.5
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000797 Homo sapiens dopamine receptor D4 (DRD4), mRNA. On-demand TBD TBD
Title An historical perspective on 'The world-wide distribution of allele frequencies at the human dopamine D4 receptor locus' .
Author Kidd KK, Pakstis AJ and Yun L.
Journal Hum. Genet. 133 (4), 431-433 (2014)
Title No association between DRD4 gene and SRI treatment response in obsessive compulsive disorder: need for a novel approach .
Author Viswanath,B., Taj M,J. RJ, Purushottam,M., Kandavel,T., Shetty,P.H., Reddy,Y.C. and Jain,S.
Journal Asian J Psychiatr 6 (4), 347-348 (2013)
Title Multivariate analysis of dopaminergic gene variants as risk factors of heroin dependence .
Author Vereczkei A, Demetrovics Z, Szekely A, Sarkozy P, Antal P, Szilagyi A, Sasvari-Szekely M and Barta C.
Journal PLoS ONE 8 (6), E66592 (2013)
Title [Genetic markers for trait anxiety as one of the risk factors for cardiovascular diseases (WHO-MONICA program, MONICA-psychosocial subprogram)] .
Author Gafarov,V.V., Voevoda,M.I., Gromova,E.A., Maksimov,V.N., Gagulin,I.V., Iudin,N.S., Gafarova,A.V. and Mishakova,T.M.
Journal Ter. Arkh. 85 (4), 47-51 (2013)
Title D4 dopamine receptor-mediated signaling events determined in transfected Chinese hamster ovary cells .
Author Chio CL, Drong RF, Riley DT, Gill GS, Slightom JL and Huff RM.
Journal J. Biol. Chem. 269 (16), 11813-11819 (1994)
Title Molecular modelling of D2-like dopamine receptors .
Author Livingstone CD, Strange PG and Naylor LH.
Journal Biochem. J. 287 (PT 1), 277-282 (1992)
Title Multiple dopamine D4 receptor variants in the human population .
Author Van Tol HH, Wu CM, Guan HC, Ohara K, Bunzow JR, Civelli O, Kennedy J, Seeman P, Niznik HB and Jovanovic V.
Journal Nature 358 (6382), 149-152 (1992)
Title The D4 dopamine receptor (DRD4) maps to distal 11p close to HRAS .
Author Gelernter J, Kennedy JL, van Tol HH, Civelli O and Kidd KK.
Journal Genomics 13 (1), 208-210 (1992)
Title Cloning of the gene for a human dopamine D4 receptor with high affinity for the antipsychotic clozapine .
Author Van Tol HH, Bunzow JR, Guan HC, Sunahara RK, Seeman P, Niznik HB and Civelli O.
Journal Nature 350 (6319), 610-614 (1991)
Title Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs .
Author Itoh H, Toyama R, Kozasa T, Tsukamoto T, Matsuoka M and Kaziro Y.
Journal J. Biol. Chem. 263 (14), 6656-6664 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.