• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dopamine receptor D4 (DRD4), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000797 Homo sapiens dopamine receptor D4 (DRD4), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_000797.3, 296010830
Length 1378 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens dopamine receptor D4 (DRD4), mRNA.
Product D(4) dopamine receptor
Comment

Summary: This gene encodes the D4 subtype of the dopamine receptor. The D4 subtype is a G-protein coupled receptor which inhibits adenylyl cyclase. It is a target for drugs which treat schizophrenia and Parkinson disease. Mutations in this gene have been associated with various behavioral phenotypes, including autonomic nervous system dysfunction, attention deficit/hyperactivity disorder, and the personality trait of novelty seeking. This gene contains a polymorphic number (2-10 copies) of tandem 48 nt repeats; the sequence shown contains four repeats. [provided by RefSeq, Jul 2008].

RefSeq NP_000788.2
CDS 1..1260
Misc Feature(1)169..>663
Misc Feature(2)169..>663
Exon (1)286..398
Gene:DRD4
Gene Synonym:D4DR
Exon (2)399..1057
Gene:DRD4
Gene Synonym:D4DR
Exon (3)1058..1363
Gene:DRD4
Gene Synonym:D4DR
Translation MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPSLPQDPCGPDCAPPAPG LPPDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWT PFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
30+dbSNP:
30+c, gdbSNP:12720386
31+c, gdbSNP:189482961
87+, gcatctgcggggdbSNP:4646983
112+c, gdbSNP:76423882
147+c, tdbSNP:192669730
149+a, cdbSNP:185063439
171+c, gdbSNP:201211288
189+c, tdbSNP:141565361
198+a, gdbSNP:146404200
220+a, gdbSNP:199876324
222+a, gdbSNP:139480839
231+a, gdbSNP:144215684
232+a, gdbSNP:146562378
235+g, tdbSNP:139782868
249+c, tdbSNP:149808759
250+a, gdbSNP:145562859
277+c, tdbSNP:148883863
328+dbSNP:
328+a, gdbSNP:143594804
369+c, tdbSNP:147645347
380+a, gdbSNP:199795245
492..493+dbSNP:
492..493+, ggggggdbSNP:143897291
581+g, tdbSNP:1800443
602+c, tdbSNP:199609858
603+c, tdbSNP:199869206
617+a, cdbSNP:145777890
635+a, gdbSNP:201764493
648+c, tdbSNP:200515603
662+a, gdbSNP:138691183
663+c, gdbSNP:141203143
680+a, gdbSNP:150331478
683+c, tdbSNP:138885045
708+c, tdbSNP:4991148
709+c, tdbSNP:4991149
710+g, tdbSNP:4991150
711+a, tdbSNP:4991151
841+c, gdbSNP:3889692
850+a, gdbSNP:34662058
870+c, tdbSNP:762502
938+c, gdbSNP:200686422
1004+c, gdbSNP:200996360
1005+c, gdbSNP:12720410
1016+a, gdbSNP:199815231
1032+c, tdbSNP:200069417
1056+c, gdbSNP:201878429
1068+dbSNP:
1068+c, gdbSNP:199628904
1074+c, gdbSNP:201886833
1075+g, tdbSNP:200086731
1089+c, tdbSNP:936463
1107+a, gdbSNP:34773603
1153+a, gdbSNP:201770727
1154+c, tdbSNP:149408856
1159+g, tdbSNP:74991942
1191+c, tdbSNP:139758515
1218+c, gdbSNP:142719624
1235+g, tdbSNP:115232659
1246+c, tdbSNP:184197348
1264+a, gdbSNP:201902931
1337+c, gdbSNP:116247796
Gene SymbolDRD4
Gene SynonymD4DR
Chromosome11
Locus Map11p15.5
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000797 Homo sapiens dopamine receptor D4 (DRD4), mRNA. On-demand TBD TBD
Title DRD4 genotype predicts longevity in mouse and human .
Author Grady,D.L., Thanos,P.K., Corrada,M.M., Barnett,J.C. Jr., Ciobanu,V., Shustarovich,D., Napoli,A., Moyzis,A.G., Grandy,D., Rubinstein,M., Wang,G.J., Kawas,C.H., Chen,C., Dong,Q., Wang,E., Volkow,N.D. and Moyzis,R.K.
Journal J. Neurosci. 33 (1), 286-291 (2013)
Title Evocative gene-parenting correlations and academic performance at first grade: an exploratory study .
Author Propper,C.B., Shanahan,M.J., Russo,R. and Mills-Koonce,W.R.
Journal Dev. Psychopathol. 24 (4), 1265-1282 (2012)
Title Parenting and Child DRD4 Genotype Interact to Predict Children's Early Emerging Effortful Control .
Author Smith,H.J., Sheikh,H.I., Dyson,M.W., Olino,T.M., Laptook,R.S., Durbin,C.E., Hayden,E.P., Singh,S.M. and Klein,D.N.
Journal Child Dev 83 (6), 1932-1944 (2012)
Title Association analysis of dopaminergic gene variants (Comt, Drd4 And Dat1) with Alzheimer s disease .
Author Lin,W.Y., Wu,B.T., Lee,C.C., Sheu,J.J., Liu,S.H., Wang,W.F., Tsai,C.H., Liu,H.P. and Tsai,F.J.
Journal J. Biol. Regul. Homeost. Agents 26 (3), 401-410 (2012)
Title D4 dopamine receptor-mediated signaling events determined in transfected Chinese hamster ovary cells .
Author Chio,C.L., Drong,R.F., Riley,D.T., Gill,G.S., Slightom,J.L. and Huff,R.M.
Journal J. Biol. Chem. 269 (16), 11813-11819 (1994)
Title Molecular modelling of D2-like dopamine receptors .
Author Livingstone,C.D., Strange,P.G. and Naylor,L.H.
Journal Biochem. J. 287 (PT 1), 277-282 (1992)
Title Multiple dopamine D4 receptor variants in the human population .
Author Van Tol,H.H., Wu,C.M., Guan,H.C., Ohara,K., Bunzow,J.R., Civelli,O., Kennedy,J., Seeman,P., Niznik,H.B. and Jovanovic,V.
Journal Nature 358 (6382), 149-152 (1992)
Title The D4 dopamine receptor (DRD4) maps to distal 11p close to HRAS .
Author Gelernter,J., Kennedy,J.L., van Tol,H.H., Civelli,O. and Kidd,K.K.
Journal Genomics 13 (1), 208-210 (1992)
Title Cloning of the gene for a human dopamine D4 receptor with high affinity for the antipsychotic clozapine .
Author Van Tol,H.H., Bunzow,J.R., Guan,H.C., Sunahara,R.K., Seeman,P., Niznik,H.B. and Civelli,O.
Journal Nature 350 (6319), 610-614 (1991)
Title Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs .
Author Itoh,H., Toyama,R., Kozasa,T., Tsukamoto,T., Matsuoka,M. and Kaziro,Y.
Journal J. Biol. Chem. 263 (14), 6656-6664 (1988)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.