• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dopamine receptor D5 (DRD5), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19349 Homo sapiens dopamine receptor D5 (DRD5), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu19349C Homo sapiens dopamine receptor D5 (DRD5), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000798.4, 171919773
Length 1434 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens dopamine receptor D5 (DRD5), mRNA.
Product D(1B) dopamine receptor
Comment

Summary: This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data.

RefSeq NP_000789.1
CDS 397..1830
Misc Feature(1)352..354
Misc Feature(2)514..594
Misc Feature(3)514..594
Misc Feature(4)583..1473
Misc Feature(5)628..708
Misc Feature(6)739..804
Misc Feature(7)<763..>921
Misc Feature(8)871..936
Misc Feature(9)1066..1134
Misc Feature(10)1285..1356
Misc Feature(11)1417..1476
Exon (1)1..2376
Gene:DRD5
Gene Synonym:DBDR; DRD1B; DRD1L2
Translation MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
40+dbSNP:
40+a, tdbSNP:12504432
71+a, gdbSNP:373637865
complement(171)-g, cdbSNP:2076907
185+a, cdbSNP:371572831
228+a, gdbSNP:375251229
302+a, gdbSNP:372681931
365+g, tdbSNP:368710755
392+c, tdbSNP:200812406
393+c, tdbSNP:368348754
448+g, tdbSNP:371107353
462+a, gdbSNP:191825696
518+c, tdbSNP:201330876
535+c, gdbSNP:144460797
545+a, tdbSNP:201926104
558+c, tdbSNP:199687249
559+c, tdbSNP:2227839
561+g, tdbSNP:145405809
571+a, gdbSNP:377175551
577+a, gdbSNP:113223975
581+c, gdbSNP:2227840
618+c, gdbSNP:201023282
620+c, tdbSNP:151282040
648+c, tdbSNP:2227848
658+c, tdbSNP:148402761
659+g, tdbSNP:6282
660+c, tdbSNP:76288744
697+a, gdbSNP:147038465
712+c, tdbSNP:147655139
714+c, tdbSNP:113695344
720+c, gdbSNP:184288806
725+a, gdbSNP:2227849
728+a, cdbSNP:201570391
735+a, cdbSNP:370317852
739+a, gdbSNP:372277553
741+c, gdbSNP:374043983
771+c, tdbSNP:2227841
810+c, tdbSNP:368255650
819+a, cdbSNP:150176923
906+a, cdbSNP:149304627
907+a, gdbSNP:143535200
920+c, tdbSNP:200733038
923+c, tdbSNP:375459639
962+a, gdbSNP:369087783
964+g, tdbSNP:144132215
985+c, tdbSNP:372770621
989+a, c, tdbSNP:187886787
1011+c, gdbSNP:368793452
1015+g, tdbSNP:2227845
1026+c, tdbSNP:2227846
1027+a, gdbSNP:137945596
1098+c, tdbSNP:199843999
1102+a, tdbSNP:371771975
1119+g, tdbSNP:142417212
1120+a, gdbSNP:202046441
1143+c, tdbSNP:376790945
1165+c, tdbSNP:77784509
1171+a, gdbSNP:200119048
1192+g, tdbSNP:371407561
1200+c, gdbSNP:73805846
1221+a, cdbSNP:201762034
1226+c, gdbSNP:199827411
1230+a, cdbSNP:139837734
1231+a, gdbSNP:200800209
1251+c, gdbSNP:201697048
1252+a, g, tdbSNP:199842757
1253+c, tdbSNP:2227850
1265+a, cdbSNP:374715955
1271+c, gdbSNP:141145675
1285+a, cdbSNP:2227851
1287+c, tdbSNP:201707615
1293+a, gdbSNP:2227844
1304+a, gdbSNP:376489659
1314+a, gdbSNP:202018458
1340+c, tdbSNP:150701938
1355+c, gdbSNP:139964299
1360+c, tdbSNP:112029473
1361+g, tdbSNP:371927056
1374+c, tdbSNP:6283
1375+a, gdbSNP:113828117
1377+a, gdbSNP:369500815
1385+a, cdbSNP:1800762
1386+a, gdbSNP:139981364
1401+a, cdbSNP:145497708
1440+c, tdbSNP:142363404
1455+a, gdbSNP:200984113
1477+g, tdbSNP:143674432
1482+c, gdbSNP:376696753
1485+c, gdbSNP:143226097
1493+a, gdbSNP:151227402
1497+g, tdbSNP:370625858
1520+a, gdbSNP:370032473
1558+a, tdbSNP:373931239
1597+a, gdbSNP:376053096
1615+a, gdbSNP:370199592
1632+c, tdbSNP:6281
1680+c, tdbSNP:201092734
1681+g, tdbSNP:372758943
1709+c, tdbSNP:150352708
1733+a, gdbSNP:376052395
1791+a, gdbSNP:142559173
1849+a, cdbSNP:374749357
complement(1877)-g, adbSNP:1967551
1881+a, cdbSNP:372890003
1897+a, cdbSNP:113892809
1910..1911+, tdbSNP:35127018
1950+g, tdbSNP:189072747
1956+c, gdbSNP:181467183
1979+c, tdbSNP:186756507
complement(2008)-c, adbSNP:1967550
2025+a, gdbSNP:191141694
2098+, adbSNP:34514924
2138+c, tdbSNP:377000033
2141+a, cdbSNP:371426510
2164+g, tdbSNP:200396084
2209..2210+, tgdbSNP:151074574
complement(2264)-g, adbSNP:141292564
2292+c, gdbSNP:180936488
2301+g, tdbSNP:185764800
2327+a, gdbSNP:150796194
Gene SymbolDRD5
Gene SynonymDBDR; DRD1B; DRD1L2
Chromosome4
Locus Map4p16.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000798 Homo sapiens dopamine receptor D5 (DRD5), mRNA. In-stock $99.00 5-7
Title D5 dopamine receptor carboxyl tail involved in D5-D2 heteromer formation .
Author O'Dowd BF, Nguyen T, Ji X and George SR.
Journal Biochem. Biophys. Res. Commun. 431 (3), 586-589 (2013)
Title Sorting nexin 1 loss results in D5 dopamine receptor dysfunction in human renal proximal tubule cells and hypertension in mice .
Author Villar VA, Jones JE, Armando I, Asico LD, Escano CS Jr, Lee H, Wang X, Yang Y, Pascua-Crusan AM, Palmes-Saloma CP, Felder RA and Jose PA.
Journal J. Biol. Chem. 288 (1), 152-163 (2013)
Title [Dopamine receptor signaling regulates human osteoclastogenesis] .
Author Hanami K, Nakano K and Tanaka Y.
Journal Nihon Rinsho Meneki Gakkai Kaishi 36 (1), 35-39 (2013)
Title Adenosine, dopamine and serotonin receptors imbalance in lymphocytes of Lesch-Nyhan patients .
Author Garcia MG, Puig JG and Torres RJ.
Journal J. Inherit. Metab. Dis. 35 (6), 1129-1135 (2012)
Title Dopamine and angiotensin type 2 receptors cooperatively inhibit sodium transport in human renal proximal tubule cells .
Author Gildea JJ, Wang X, Shah N, Tran H, Spinosa M, Van Sciver R, Sasaki M, Yatabe J, Carey RM, Jose PA and Felder RA.
Journal Hypertension 60 (2), 396-403 (2012)
Title Chromosomal localization of three human D5 dopamine receptor genes .
Author Grandy DK, Allen LJ, Zhang Y, Magenis RE and Civelli O.
Journal Genomics 13 (4), 968-973 (1992)
Title Localization of the D5 dopamine receptor gene to human chromosome 4p15.1-p15.3, centromeric to the Huntington's disease locus .
Author Eubanks JH, Altherr M, Wagner-McPherson C, McPherson JD, Wasmuth JJ and Evans GA.
Journal Genomics 12 (3), 510-516 (1992)
Title The human D5 dopamine receptor (DRD5) maps on chromosome 4 .
Author Polymeropoulos MH, Xiao H and Merril CR.
Journal Genomics 11 (3), 777-778 (1991)
Title Cloning, molecular characterization, and chromosomal assignment of a gene encoding a second D1 dopamine receptor subtype: differential expression pattern in rat brain compared with the D1A receptor .
Author Tiberi M, Jarvie KR, Silvia C, Falardeau P, Gingrich JA, Godinot N, Bertrand L, Yang-Feng TL, Fremeau RT Jr and Caron MG.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (17), 7491-7495 (1991)
Title Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1 .
Author Sunahara RK, Guan HC, O'Dowd BF, Seeman P, Laurier LG, Ng G, George SR, Torchia J, Van Tol HH and Niznik HB.
Journal Nature 350 (6319), 614-619 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.