• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dopamine receptor D5 (DRD5), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000798 Homo sapiens dopamine receptor D5 (DRD5), mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_000798.4, 171919773
Length 2398 bp
Structure linear
Update Date 13-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens dopamine receptor D5 (DRD5), mRNA.
Product D(1B) dopamine receptor
Comment

Summary: This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data.

RefSeq NP_000789.1
CDS 397..1830
Misc Feature(1)352..354
Misc Feature(2)514..594
Misc Feature(3)514..594
Misc Feature(4)583..1473
Misc Feature(5)628..708
Misc Feature(6)739..804
Misc Feature(7)<763..>921
Misc Feature(8)871..936
Misc Feature(9)1066..1134
Misc Feature(10)1285..1356
Misc Feature(11)1417..1476
Exon (1)1..2376
Gene:DRD5
Gene Synonym:DBDR; DRD1B; DRD1L2
Translation MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
12+dbSNP:
12+c, tdbSNP:4004753
17+a, gdbSNP:183445
40+a, tdbSNP:12504432
57+a, gdbSNP:149417
100+c, gdbSNP:2531507
171+c, gdbSNP:2076907
172+a, cdbSNP:2537171
220+c, tdbSNP:2537170
262+a, tdbSNP:3894891
276+c, tdbSNP:2840882
278+a, gdbSNP:56339300
367+c, tdbSNP:71239315
392+c, tdbSNP:200812406
419+c, tdbSNP:75154451
447+c, tdbSNP:71239765
462+a, gdbSNP:191825696
471+a, gdbSNP:2537169
518+c, tdbSNP:201330876
535+c, gdbSNP:144460797
538+a, gdbSNP:2840884
545+a, tdbSNP:201926104
547+a, gdbSNP:2659229
558+c, tdbSNP:199687249
559+c, tdbSNP:2227839
561+g, tdbSNP:145405809
566+a, gdbSNP:149202671
567+c, tdbSNP:142396359
577+a, gdbSNP:113223975
577+c, tdbSNP:3881832
581+c, gdbSNP:2227840
595+c, tdbSNP:2840885
618+c, gdbSNP:201023282
620+c, tdbSNP:151282040
645..646+cc, gtdbSNP:71257077
645+c, tdbSNP:4004748
646+c, gdbSNP:3970035
648+c, tdbSNP:2227848
658+c, tdbSNP:148402761
659+g, tdbSNP:6282
660+c, tdbSNP:76288744
682+a, gdbSNP:3881834
697+a, gdbSNP:147038465
712+c, tdbSNP:147655139
714+a, gdbSNP:2537168
714+c, tdbSNP:113695344
720+c, gdbSNP:184288806
725+a, gdbSNP:2227849
728+a, cdbSNP:201570391
771+c, tdbSNP:2227841
792..793+c, tdbSNP:3894830
806+c, gdbSNP:2840886
819+a, cdbSNP:150176923
825+g, tdbSNP:112350074
841+a, gdbSNP:138634841
880+c, gdbSNP:2840887
881+c, tdbSNP:151004
906+a, cdbSNP:149304627
907+a, gdbSNP:143535200
920+c, tdbSNP:200733038
964+g, tdbSNP:144132215
989+a, cdbSNP:187886787
1015+g, tdbSNP:2227845
1026+c, tdbSNP:2227846
1026+c, tdbSNP:2840888
1027+a, gdbSNP:137945596
1078+c, tdbSNP:2840889
1094+a, gdbSNP:2227843
1094+a, gdbSNP:2840890
1098+c, tdbSNP:199843999
1108+a, gdbSNP:2227852
1119+g, tdbSNP:142417212
1120+a, gdbSNP:202046441
1136+a, gdbSNP:2227847
1136+c, tdbSNP:4004771
1144+g, tdbSNP:151003
1165+a, gdbSNP:4004770
1165+c, tdbSNP:77784509
1171+a, gdbSNP:200119048
1180+a, gdbSNP:4004769
1180+c, tdbSNP:2227853
1200+c, gdbSNP:73805846
1202+c, tdbSNP:2227842
1219..1220+, adbSNP:113868686
1221+a, cdbSNP:201762034
1226+c, gdbSNP:199827411
1230+a, cdbSNP:139837734
1231+a, gdbSNP:2840891
1231+a, gdbSNP:200800209
1251+c, gdbSNP:201697048
1252+a, g, tdbSNP:199842757
1253+c, tdbSNP:2227850
1271+c, gdbSNP:141145675
1273+c, tdbSNP:4004767
1283+g, tdbSNP:113960319
1285+a, cdbSNP:2227851
1285+g, tdbSNP:1986576
1287+c, tdbSNP:201707615
1293+a, gdbSNP:2227844
1293+c, tdbSNP:4004765
1314+a, gdbSNP:202018458
1340+c, tdbSNP:150701938
1353+c, tdbSNP:2840892
1355+c, gdbSNP:139964299
1360+a, gdbSNP:4004763
1360+c, tdbSNP:112029473
1374+c, tdbSNP:6283
1375+a, gdbSNP:113828117
1385+a, cdbSNP:1800762
1386+a, gdbSNP:139981364
1401+a, cdbSNP:145497708
1422+c, tdbSNP:2840893
1429+a, gdbSNP:147690314
1440+c, tdbSNP:142363404
1455+a, gdbSNP:200984113
1477+g, tdbSNP:143674432
1485+c, gdbSNP:143226097
1492+a, gdbSNP:4004792
1493+a, gdbSNP:151227402
1555+a, gdbSNP:2659230
1595+c, tdbSNP:71252103
1625+c, tdbSNP:4004791
1632+c, tdbSNP:6281
1648+a, c, gdbSNP:2840894
1664+aa, ggdbSNP:71272615
1664+c, tdbSNP:4004790
1665+c, tdbSNP:4004789
1677+a, gdbSNP:3933991
1680+c, tdbSNP:201092734
1687+a, gdbSNP:2659231
1709+c, tdbSNP:150352708
1725+a, gdbSNP:3205146
1741+a, gdbSNP:151002
1742+a, cdbSNP:2659232
1749+a, tdbSNP:16888557
1761+a, gdbSNP:16888561
1790+c, tdbSNP:137975609
1791+a, gdbSNP:142559173
1803+c, tdbSNP:2658038
1815+a, gdbSNP:1064139
1877+a, gdbSNP:1967551
1897+a, cdbSNP:113892809
1909+c, gdbSNP:2537167
1910..1911+, tdbSNP:35127018
1923+c, gdbSNP:3894827
1949+a, gdbSNP:2659233
1950+g, tdbSNP:189072747
1956+c, gdbSNP:181467183
1979+c, tdbSNP:186756507
1986+a, gdbSNP:67973382
2008+a, cdbSNP:1967550
2025+a, gdbSNP:191141694
2097..2098+, tdbSNP:57995414
2097..2098+, ttttdbSNP:4071210
2098+, adbSNP:34514924
2109..2110+, aaaa, aaaaaadbSNP:56361854
2109+a, tdbSNP:2537165
2109+a, tdbSNP:75780005
2142+a, gdbSNP:112681388
2164+g, tdbSNP:200396084
2209..2210+, tgdbSNP:151074574
2218+c, tdbSNP:2537164
2235+c, gdbSNP:151001
2242+c, gdbSNP:2659235
2264+a, gdbSNP:141292564
2292+c, gdbSNP:180936488
2301+g, tdbSNP:185764800
2327+a, gdbSNP:150796194
Gene SymbolDRD5
Gene SynonymDBDR; DRD1B; DRD1L2
Chromosome4
Locus Map4p16.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000798 Homo sapiens dopamine receptor D5 (DRD5), mRNA. In-stock $509.00 $460.00 12
Title Sorting nexin 1 loss results in D5 dopamine receptor dysfunction in human renal proximal tubule cells and hypertension in mice .
Author Villar,V.A., Jones,J.E., Armando,I., Asico,L.D., Escano,C.S. Jr., Lee,H., Wang,X., Yang,Y., Pascua-Crusan,A.M., Palmes-Saloma,C.P., Felder,R.A. and Jose,P.A.
Journal J. Biol. Chem. 288 (1), 152-163 (2013)
Title Adenosine, dopamine and serotonin receptors imbalance in lymphocytes of Lesch-Nyhan patients .
Author Garcia,M.G., Puig,J.G. and Torres,R.J.
Journal J. Inherit. Metab. Dis. 35 (6), 1129-1135 (2012)
Title Dopamine and angiotensin type 2 receptors cooperatively inhibit sodium transport in human renal proximal tubule cells .
Author Gildea,J.J., Wang,X., Shah,N., Tran,H., Spinosa,M., Van Sciver,R., Sasaki,M., Yatabe,J., Carey,R.M., Jose,P.A. and Felder,R.A.
Journal Hypertension 60 (2), 396-403 (2012)
Title Association study of 45 candidate genes in nicotine dependence in Han Chinese .
Author Wei,J., Chu,C., Wang,Y., Yang,Y., Wang,Q., Li,T., Zhang,L. and Ma,X.
Journal Addict Behav 37 (5), 622-626 (2012)
Title Dopamine D4 and D5 receptor gene variant effects on clozapine response in schizophrenia: replication and exploration .
Author Hwang,R., Tiwari,A.K., Zai,C.C., Felsky,D., Remington,E., Wallace,T., Tong,R.P., Souza,R.P., Oh,G., Potkin,S.G., Lieberman,J.A., Meltzer,H.Y. and Kennedy,J.L.
Journal Prog. Neuropsychopharmacol. Biol. Psychiatry 37 (1), 62-75 (2012)
Title Chromosomal localization of three human D5 dopamine receptor genes .
Author Grandy,D.K., Allen,L.J., Zhang,Y., Magenis,R.E. and Civelli,O.
Journal Genomics 13 (4), 968-973 (1992)
Title Localization of the D5 dopamine receptor gene to human chromosome 4p15.1-p15.3, centromeric to the Huntington's disease locus .
Author Eubanks,J.H., Altherr,M., Wagner-McPherson,C., McPherson,J.D., Wasmuth,J.J. and Evans,G.A.
Journal Genomics 12 (3), 510-516 (1992)
Title The human D5 dopamine receptor (DRD5) maps on chromosome 4 .
Author Polymeropoulos,M.H., Xiao,H. and Merril,C.R.
Journal Genomics 11 (3), 777-778 (1991)
Title Cloning, molecular characterization, and chromosomal assignment of a gene encoding a second D1 dopamine receptor subtype: differential expression pattern in rat brain compared with the D1A receptor .
Author Tiberi,M., Jarvie,K.R., Silvia,C., Falardeau,P., Gingrich,J.A., Godinot,N., Bertrand,L., Yang-Feng,T.L., Fremeau,R.T. Jr. and Caron,M.G.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (17), 7491-7495 (1991)
Title Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1 .
Author Sunahara,R.K., Guan,H.C., O'Dowd,B.F., Seeman,P., Laurier,L.G., Ng,G., George,S.R., Torchia,J., Van Tol,H.H. and Niznik,H.B.
Journal Nature 350 (6319), 614-619 (1991)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.