• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens erythropoietin (EPO), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu20340 Homo sapiens erythropoietin (EPO), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu20340C Homo sapiens erythropoietin (EPO), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000799.2, 62240996
Length 582 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens erythropoietin (EPO), mRNA.
Product erythropoietin precursor
Comment

Summary: This gene is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. [provided by RefSeq, Jul 2008].

RefSeq NP_000790.2
CDS 182..763
Misc Feature(1)116..118
Misc Feature(2)269..760
Misc Feature(3)order(281..283,743..745)
Misc Feature(4)332..334
Misc Feature(5)order(347..349,359..361)
Misc Feature(6)374..376
Misc Feature(7)509..511
Misc Feature(8)638..640
Exon (1)1..194
Gene:EPO
Gene Synonym:EP; MVCD2
Exon (2)195..340
Gene:EPO
Gene Synonym:EP; MVCD2
Exon (3)341..427
Gene:EPO
Gene Synonym:EP; MVCD2
Exon (4)428..607
Gene:EPO
Gene Synonym:EP; MVCD2
Exon (5)608..1330
Gene:EPO
Gene Synonym:EP; MVCD2
Translation MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL KLYTGEACRTGDR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
10+dbSNP:
10+c, gdbSNP:376713532
127..128+, adbSNP:34144627
142+c, tdbSNP:141701177
218+dbSNP:
218+c, tdbSNP:77762674
235+a, gdbSNP:73409072
289+c, tdbSNP:140045752
293+a, gdbSNP:200020971
328+c, gdbSNP:149877548
342+dbSNP:
342+c, tdbSNP:201069425
352+c, tdbSNP:61735970
356+c, tdbSNP:369033773
389+a, gdbSNP:62483572
409..410+, tdbSNP:34937405
418+a, gdbSNP:57694744
431+dbSNP:
431+a, gdbSNP:137953994
442+c, tdbSNP:140683829
443+g, tdbSNP:370493713
452..453+, gdbSNP:71517124
475+a, gdbSNP:374875798
488+c, tdbSNP:367645892
522+c, tdbSNP:11976235
557+a, gdbSNP:372093552
570+a, gdbSNP:200241729
573+c, gdbSNP:376551627
590+c, tdbSNP:369003114
591+a, gdbSNP:376745626
599+c, gdbSNP:1126887
611+dbSNP:
611+a, gdbSNP:201051019
621+c, gdbSNP:149431976
625+g, tdbSNP:375550656
633+c, tdbSNP:370232752
634+a, gdbSNP:78925197
648+c, tdbSNP:373734290
668+c, gdbSNP:201326665
677+c, tdbSNP:73409075
733+a, cdbSNP:144031260
740+g, tdbSNP:368744075
758+, adbSNP:369859204
758+a, gdbSNP:371108812
768+a, gdbSNP:375035296
793+a, gdbSNP:189775061
809+c, tdbSNP:200436414
826+c, tdbSNP:202242218
856+g, tdbSNP:141911577
869+c, tdbSNP:192883541
906+a, gdbSNP:150610526
942+a, gdbSNP:184441242
1030+c, gdbSNP:78182250
1098+c, tdbSNP:77450727
1114+g, tdbSNP:188830852
1145+g, tdbSNP:564449
1225+a, gdbSNP:114461287
Gene SymbolEPO
Gene SynonymEP; MVCD2
Chromosome7
Locus Map7q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000799 Homo sapiens erythropoietin (EPO), mRNA. In-stock $99.00 5-7
Title Paraneoplastic hormones: parathyroid hormone-related protein (PTHrP) and erythropoietin (EPO) are related to vascular endothelial growth factor (VEGF) expression in clear cell renal cell carcinoma .
Author Feng CC, Ding GX, Song NH, Li X, Wu Z, Jiang HW and Ding Q.
Journal Tumour Biol. 34 (6), 3471-3476 (2013)
Title Erythropoietin is involved in the angiogenic potential of bone marrow macrophages in multiple myeloma .
Author De Luisi A, Binetti L, Ria R, Ruggieri S, Berardi S, Catacchio I, Racanelli V, Pavone V, Rossini B, Vacca A and Ribatti D.
Journal Angiogenesis 16 (4), 963-973 (2013)
Title Asymmetric dimethylarginine in response to recombinant tissue-type plasminogen activator and erythropoietin in acute stroke .
Author Worthmann H, Martens-Lobenhoffer J, Joumaah M, Li N, Lichtinghagen R, Hecker H, Kielstein JT, Ehrenreich H, Bode-Boger SM and Weissenborn K.
Journal Stroke 44 (8), 2128-2133 (2013)
Title The role and regulation of secretion of erythropoietin in pregnancy .
Author Kowalska-Kanka A, Maciejewski T and Niemiec KT.
Journal Med Wieku Rozwoj 17 (3), 270-275 (2013)
Title Urine erythropoietin level is associated with kidney and brain injury in critically ill neonates .
Author Li Y, Xiao Z, Yan J, Li X, Wang Q, Zhu H, Pan J, Zhu X, Wang J and Feng X.
Journal Neonatology 104 (2), 87-94 (2013)
Title Structures and functional roles of the sugar chains of human erythropoietins .
Author Takeuchi M and Kobata A.
Journal Glycobiology 1 (4), 337-346 (1991)
Title Regulation of the erythropoietin gene: evidence that the oxygen sensor is a heme protein .
Author Goldberg MA, Dunning SP and Bunn HF.
Journal Science 242 (4884), 1412-1415 (1988)
Title Site-specific glycosylation of human recombinant erythropoietin: analysis of glycopeptides or peptides at each glycosylation site by fast atom bombardment mass spectrometry .
Author Sasaki H, Ochi N, Dell A and Fukuda M.
Journal Biochemistry 27 (23), 8618-8626 (1988)
Title Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells .
Author Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N and Kobata A.
Journal J. Biol. Chem. 263 (8), 3657-3663 (1988)
Title Regional assignment of the erythropoietin gene to human chromosome region 7pter----q22 .
Author Watkins,P.C., Eddy,R., Hoffman,N., Stanislovitis,P., Beck,A.K., Galli,J., Vellucci,V., Gusella,J.F. and Shows,T.B.
Journal Cytogenet. Cell Genet. 42 (4), 214-218 (1986)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.