• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens growth hormone releasing hormone receptor (GHRHR), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18044 Homo sapiens growth hormone releasing hormone receptor (GHRHR), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu18044C Homo sapiens growth hormone releasing hormone receptor (GHRHR), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000823.3, 297307106
Length 1272 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens growth hormone releasing hormone receptor (GHRHR), mRNA.
Product growth hormone-releasing hormone receptor precursor
Comment

Summary: This gene encodes a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in this gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature. [provided by RefSeq, Jun 2010].

RefSeq NP_000814.2
CDS 49..1320
Misc Feature(1)202..384
Misc Feature(2)424..1164
Misc Feature(3)445..504
Misc Feature(4)535..591
Misc Feature(5)661..729
Misc Feature(6)769..834
Misc Feature(7)889..960
Misc Feature(8)1036..1092
Misc Feature(9)1132..1191
Exon (1)1..105
Gene:GHRHR
Gene Synonym:GHRFR; GRFR; IGHD1B
Exon (2)106..208
Gene:GHRHR
Gene Synonym:GHRFR; GRFR; IGHD1B
Exon (3)209..316
Gene:GHRHR
Gene Synonym:GHRFR; GRFR; IGHD1B
Exon (4)317..414
Gene:GHRHR
Gene Synonym:GHRFR; GRFR; IGHD1B
Exon (5)415..512
Gene:GHRHR
Gene Synonym:GHRFR; GRFR; IGHD1B
Exon (6)513..645
Gene:GHRHR
Gene Synonym:GHRFR; GRFR; IGHD1B
Exon (7)646..799
Gene:GHRHR
Gene Synonym:GHRFR; GRFR; IGHD1B
Exon (8)800..860
Gene:GHRHR
Gene Synonym:GHRFR; GRFR; IGHD1B
Exon (9)861..930
Gene:GHRHR
Gene Synonym:GHRFR; GRFR; IGHD1B
Exon (10)931..1022
Gene:GHRHR
Gene Synonym:GHRFR; GRFR; IGHD1B
Exon (11)1023..1152
Gene:GHRHR
Gene Synonym:GHRFR; GRFR; IGHD1B
Exon (12)1153..1194
Gene:GHRHR
Gene Synonym:GHRFR; GRFR; IGHD1B
Exon (13)1195..1607
Gene:GHRHR
Gene Synonym:GHRFR; GRFR; IGHD1B
Translation MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWD GLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLA EEESYFSTVKIIYTVGHSISIVALFVAITILVALRRLHCPRNYVHTQLFTTFILKAGAVF LKDAALFHSDDTDHCSFSTVLCKVSVAASHFATMTNFSWLLAEAVYLNCLLASTSPSSRR AFWWLVLAGWGLPVLFTGTWVSCKLAFEDIACWDLDDTSPYWWIIKGPIVLSVGVNFGLF LNIIRILVRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIIFNFLPDNAGLGIRLPL ELGLGSFQGFIVAILYCFLNQEVRTEISRKWHGHDPELLPAWRTRAKWTTPSRSAAKVLT SMC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
4+dbSNP:
4+c, tdbSNP:2302021
28+a, gdbSNP:199748692
35+c, tdbSNP:372803803
54+c, tdbSNP:148704543
55+c, tdbSNP:374847216
58+c, tdbSNP:142361839
70+a, gdbSNP:151265232
77+g, tdbSNP:139599160
95+c, tdbSNP:142833343
101+c, tdbSNP:202243828
115+dbSNP:
115+c, tdbSNP:372707560
141+c, tdbSNP:143429066
174+a, cdbSNP:146723194
183+a, tdbSNP:201978703
186+a, gdbSNP:375206873
189+c, gdbSNP:140417128
199+a, gdbSNP:141571344
217+dbSNP:
217+a, gdbSNP:4988496
219+a, gdbSNP:369751652
248+c, tdbSNP:201893637
262+g, tdbSNP:121918117
285+a, gdbSNP:28371558
320+dbSNP:
320+c, tdbSNP:144372265
328+c, tdbSNP:376258046
329+a, gdbSNP:200848306
340+a, gdbSNP:368351143
376+a, gdbSNP:149024880
384+c, tdbSNP:143017246
388+c, gdbSNP:200504469
407+c, tdbSNP:138751215
411+g, tdbSNP:4988498
420+dbSNP:
420+g, tdbSNP:112879406
451+a, gdbSNP:201267804
479+a, tdbSNP:121918118
483+c, tdbSNP:368335119
529..530+dbSNP:
529..530+, cdbSNP:35515360
537+c, tdbSNP:147098353
538+a, gdbSNP:138615339
546+a, cdbSNP:199684610
560+c, gdbSNP:10227922
564+a, tdbSNP:150685406
576+a, gdbSNP:139700235
586+c, tdbSNP:146301048
599+c, tdbSNP:372859999
609+c, tdbSNP:200623488
612+c, tdbSNP:740336
628+c, tdbSNP:377182945
646+dbSNP:
646+a, gdbSNP:144251858
682+a, gdbSNP:371191800
706+c, tdbSNP:146727093
708+a, gdbSNP:145466944
713+a, cdbSNP:121918120
720+c, tdbSNP:376278130
721+a, gdbSNP:28371560
755+c, tdbSNP:142710091
773+g, tdbSNP:121918119
789+c, tdbSNP:151019928
807+dbSNP:
807+c, tdbSNP:372209255
808+a, gdbSNP:375562610
825+a, gdbSNP:368859494
844+a, gdbSNP:140869993
859+a, gdbSNP:149678088
874+dbSNP:
874+a, gdbSNP:201748357
876+c, tdbSNP:147768462
887+c, tdbSNP:141237359
918+c, tdbSNP:369716383
921+c, tdbSNP:374443097
924+c, gdbSNP:370074960
927+a, cdbSNP:375674796
933+dbSNP:
933+g, tdbSNP:146944568
943+c, tdbSNP:267601482
962+a, gdbSNP:200472991
988+g, tdbSNP:138492645
1008+c, tdbSNP:376273824
1033+dbSNP:
1033+a, gdbSNP:121918121
1038+a, gdbSNP:369089111
1055+c, tdbSNP:149182247
1057+c, tdbSNP:202089170
1075+a, gdbSNP:372024874
1110+c, gdbSNP:143333500
1117+c, tdbSNP:376948691
1118+a, gdbSNP:201403615
1124+c, tdbSNP:200417925
1156+dbSNP:
1156+c, tdbSNP:373883983
1165+a, gdbSNP:199990600
1188+c, tdbSNP:375995048
1194+a, gdbSNP:200743419
1213+dbSNP:
1213+c, tdbSNP:200508601
1261+c, tdbSNP:28371561
1262+a, gdbSNP:189950019
1264+a, gdbSNP:141571507
1289+c, tdbSNP:146305421
1290+a, gdbSNP:28371562
1291+a, gdbSNP:142878597
1293+a, gdbSNP:181168274
1313+c, tdbSNP:2228078
1316+a, gdbSNP:139763309
1326+c, tdbSNP:369741931
1333+c, tdbSNP:142228002
1368+c, tdbSNP:374294592
1370+a, tdbSNP:200055651
1371+c, tdbSNP:185262577
1406+c, tdbSNP:35624572
1433+c, tdbSNP:190966223
1467+a, cdbSNP:2586
1541+c, tdbSNP:28371563
1556+a, cdbSNP:28371564
Gene SymbolGHRHR
Gene SynonymGHRFR; GRFR; IGHD1B
Chromosome7
Locus Map7p14
Title Isolated GH deficiency due to a GHRH receptor mutation causes hip joint problems and genu valgum, and reduces size but not density of trabecular and mixed bone .
Author Epitacio-Pereira CC, Silva GM, Salvatori R, Santana JA, Pereira FA, Gois-Junior MB, Britto AV, Oliveira CR, Souza AH, Santos EG, Campos VC, Pereira RM, Valenca EH, Barbosa RA, Farias MI, de Paula FJ, Ribeiro TV, Oliveira MC and Aguiar-Oliveira MH.
Journal J. Clin. Endocrinol. Metab. 98 (11), E1710-E1715 (2013)
Title Expression of a splice variant of the receptor for GHRH in 3T3 fibroblasts activates cell proliferation responses to GHRH analogs .
Author Kiaris H, Schally AV, Busto R, Halmos G, Artavanis-Tsakonas S and Varga JL.
Journal Proc. Natl. Acad. Sci. U.S.A. 99 (1), 196-200 (2002)
Title Isolation and sequencing of cDNAs for splice variants of growth hormone-releasing hormone receptors from human cancers .
Author Rekasi Z, Czompoly T, Schally AV and Halmos G.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (19), 10561-10566 (2000)
Title Phenotype and genetic analysis of a syndrome caused by an inactivating mutation in the growth hormone-releasing hormone receptor: Dwarfism of Sindh .
Author Maheshwari HG, Silverman BL, Dupuis J and Baumann G.
Journal J. Clin. Endocrinol. Metab. 83 (11), 4065-4074 (1998)
Title Structure and regulation of the human growth hormone-releasing hormone receptor gene .
Author Petersenn S, Rasch AC, Heyens M and Schulte HM.
Journal Mol. Endocrinol. 12 (2), 233-247 (1998)
Title Nonsense mutation in the human growth hormone-releasing hormone receptor causes growth failure analogous to the little (lit) mouse .
Author Wajnrajch MP, Gertner JM, Harbison MD, Chua SC Jr and Leibel RL.
Journal Nat. Genet. 12 (1), 88-90 (1996)
Title Identification of alternatively spliced messenger ribonucleic acid encoding truncated growth hormone-releasing hormone receptor in human pituitary adenomas .
Author Hashimoto K, Koga M, Motomura T, Kasayama S, Kouhara H, Ohnishi T, Arita N, Hayakawa T, Sato B and Kishimoto T.
Journal J. Clin. Endocrinol. Metab. 80 (10), 2933-2939 (1995)
Title Identification of human growth hormone-releasing hormone receptor splicing variants .
Author Tang J, Lagace G, Castagne J and Collu R.
Journal J. Clin. Endocrinol. Metab. 80 (8), 2381-2387 (1995)
Title Assignment of the human growth hormone-releasing hormone receptor gene (GHRHR) to 7p14 by in situ hybridization .
Author Gaylinn BD, von Kap-Herr C, Golden WL and Thorner MO.
Journal Genomics 19 (1), 193-195 (1994)
Title Molecular cloning and expression of a pituitary-specific receptor for growth hormone-releasing hormone .
Author Mayo KE.
Journal Mol. Endocrinol. 6 (10), 1734-1744 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.