• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glutamate receptor, ionotropic, N-methyl D-aspartate 2D (GRIN2D), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000836 Homo sapiens glutamate receptor, ionotropic, N-methyl D-aspartate 2D (GRIN2D), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_000836.2, 153946390
Length 5109 bp
Structure linear
Update Date 27-JAN-2014
Organism Homo sapiens (human)
Definition Homo sapiens glutamate receptor, ionotropic, N-methyl D-aspartate 2D (GRIN2D), mRNA.
Product glutamate receptor ionotropic, NMDA 2D precursor
Comment

Summary: N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D). [provided by RefSeq, Mar 2010].

RefSeq NP_000827.2
CDS 89..4099
Misc Feature(1)56..58
Misc Feature(2)56..58
Misc Feature(3)233..1342
Misc Feature(4)order(377..379,383..388,395..400,497..499,704..706,
Misc Feature(5)1484..>1795
Misc Feature(6)1544..2560
Misc Feature(7)order(1649..1651,1724..1726,2237..2239,2363..2365)
Misc Feature(8)1838..2656
Misc Feature(9)1838..1900
Misc Feature(10)2012..2014
Misc Feature(11)2057..2119
Misc Feature(12)order(2312..2314,2324..2326,2342..2344)
Misc Feature(13)2441..2458
Misc Feature(14)2621..2683
Misc Feature(15)4088..4096
Exon (1)1..62
Gene:GRIN2D
Gene Synonym:EB11; GluN2D; NMDAR2D; NR2D
Exon (2)63..553
Gene:GRIN2D
Gene Synonym:EB11; GluN2D; NMDAR2D; NR2D
Exon (3)554..1173
Gene:GRIN2D
Gene Synonym:EB11; GluN2D; NMDAR2D; NR2D
Exon (4)1174..1288
Gene:GRIN2D
Gene Synonym:EB11; GluN2D; NMDAR2D; NR2D
Exon (5)1289..1500
Gene:GRIN2D
Gene Synonym:EB11; GluN2D; NMDAR2D; NR2D
Exon (6)1501..1669
Gene:GRIN2D
Gene Synonym:EB11; GluN2D; NMDAR2D; NR2D
Exon (7)1670..1823
Gene:GRIN2D
Gene Synonym:EB11; GluN2D; NMDAR2D; NR2D
Exon (8)1824..1949
Gene:GRIN2D
Gene Synonym:EB11; GluN2D; NMDAR2D; NR2D
Exon (9)1950..2179
Gene:GRIN2D
Gene Synonym:EB11; GluN2D; NMDAR2D; NR2D
Exon (10)2180..2340
Gene:GRIN2D
Gene Synonym:EB11; GluN2D; NMDAR2D; NR2D
Exon (11)2341..2528
Gene:GRIN2D
Gene Synonym:EB11; GluN2D; NMDAR2D; NR2D
Exon (12)2529..2761
Gene:GRIN2D
Gene Synonym:EB11; GluN2D; NMDAR2D; NR2D
Exon (13)2762..5093
Gene:GRIN2D
Gene Synonym:EB11; GluN2D; NMDAR2D; NR2D
Translation MRGAGGPRGPRGPAKMLLLLALACASPFPEEAPGPGGAGGPGGGLGGARPLNVALVFSGP AYAAEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDD SRAPAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLE EYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLSAQLRSVS AQIRLLFCAREEAEPVFRAAEEAGLTGSGYVWFMVGPQLAGGGGSGAPGEPPLLPGGAPL PAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESL HRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYG RFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPE KRCCKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSL TINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVT VFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVL VWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEK NIRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGS GKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKL DIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAE AAPPPAKPPPPPQPLPSPAYPAPRPAPGPAPFVPRERASVDRWRRTKGAGPPGGAGLADG FHRYYGPIEPQGLGLGLGEARAAPRGAAGRPLSPPAAQPPQKPPPSYFAIVRDKEPAEPP AGAFPGFPSPPAPPAAAATAVGPPLCRLAFEDESPPAPARWPRSDPESQPLLGPGAGGAG GTGGAGGGAPAAPPPCRAAPPPCPYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYP YAERLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAAWHCRHCASLELLPPPRHLSCSHD GLDGGWWAPPPPPWAAGPLPRRRARCGCPRSHPHRPRASHRTPAAAAPHHHRHRRAAGGW DLPPPAPTSRSLEDLSSCPRAAPARRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDL GTRRGSAHFSSLESEV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
505+a, gdbSNP:10413649
561+dbSNP:
561+a, gdbSNP:369215761
568+c, tdbSNP:267605563
607+a, gdbSNP:147811242
643+a, gdbSNP:77950614
646..647+, cdbSNP:35658494
650+g, tdbSNP:77520296
716+a, gdbSNP:77698773
754+a, gdbSNP:373401802
775+a, gdbSNP:111439081
778+c, gdbSNP:201727209
803+a, gdbSNP:201028602
808+c, tdbSNP:200407469
811+g, tdbSNP:77992710
826+a, cdbSNP:374160642
848+a, gdbSNP:182928265
919+c, gdbSNP:377156868
942+c, tdbSNP:185295623
973+a, gdbSNP:201492347
994+c, tdbSNP:190128029
1015+a, gdbSNP:369747884
1025+c, tdbSNP:373524397
1072+c, tdbSNP:371224179
1085+a, gdbSNP:200627009
1111+g, tdbSNP:200060371
1135+c, tdbSNP:150366451
1145+a, cdbSNP:377464612
1155+a, gdbSNP:369036985
1160+c, gdbSNP:372406980
1250+dbSNP:
1250+a, gdbSNP:374787165
1264+c, tdbSNP:138100955
1278+c, tdbSNP:150870505
1477+dbSNP:
1477+a, gdbSNP:201643479
1491+g, tdbSNP:375977344
1513+dbSNP:
1513+c, tdbSNP:75699925
1514+a, gdbSNP:201139344
1522+c, tdbSNP:149544539
1527+a, tdbSNP:80005942
1532+c, tdbSNP:74672030
1533+g, tdbSNP:79729472
1537+c, tdbSNP:3786746
1569+a, gdbSNP:199554577
1571+c, tdbSNP:200267523
1601+c, tdbSNP:77806672
1609+c, gdbSNP:373061448
1639+c, tdbSNP:76779682
1642+c, tdbSNP:141634411
1648+c, gdbSNP:368206646
1678+dbSNP:
1678+c, tdbSNP:202239733
1700+a, gdbSNP:146214660
1717+c, tdbSNP:370269500
1729+c, tdbSNP:148340456
1826+dbSNP:
1826+c, tdbSNP:76227163
1846+a, gdbSNP:78900630
1877+a, gdbSNP:371559801
1936+a, gdbSNP:76163376
1943+a, gdbSNP:141530315
1993+dbSNP:
1993+g, tdbSNP:369769435
2038+c, tdbSNP:373262324
2086+c, tdbSNP:150885362
2103+c, gdbSNP:370752466
2107+c, tdbSNP:139402101
2188+dbSNP:
2188+g, tdbSNP:150071822
2204+c, tdbSNP:147244378
2210+c, tdbSNP:140715087
2237+g, tdbSNP:199984042
2359+dbSNP:
2359+c, tdbSNP:144676582
2380+c, tdbSNP:377015207
2446+a, gdbSNP:368853794
2481+a, gdbSNP:371691127
2492+a, cdbSNP:376604382
2493+c, tdbSNP:376705334
2500+c, tdbSNP:147906766
2506+a, gdbSNP:142827132
2572+dbSNP:
2572+c, tdbSNP:142606528
2603+a, gdbSNP:199930453
2695+a, gdbSNP:150993587
2704+c, tdbSNP:373581422
2785+dbSNP:
2785+c, tdbSNP:62130268
3149+c, gdbSNP:112197616
3178+g, tdbSNP:113036413
3230+c, tdbSNP:111420822
3310+a, gdbSNP:112893228
3406+a, cdbSNP:372869544
3490+c, tdbSNP:377403542
3967+c, tdbSNP:370934587
3976+c, gdbSNP:375048004
4037+a, gdbSNP:191119443
4155+a, gdbSNP:112214473
4231+g, tdbSNP:8111684
4295+c, tdbSNP:376694022
4566+c, tdbSNP:182211448
4731+c, tdbSNP:371600624
4738+a, cdbSNP:35973836
5037+c, tdbSNP:188052023
complement(5053)-g, adbSNP:149981799
Gene SymbolGRIN2D
Gene SynonymEB11; GluN2D; NMDAR2D; NR2D
Chromosome19
Locus Map19q13.33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000836 Homo sapiens glutamate receptor, ionotropic, N-methyl D-aspartate 2D (GRIN2D), mRNA. On-demand TBD TBD
Title Pilot study of iPS-derived neural cells to examine biologic effects of alcohol on human neurons in vitro .
Author Lieberman R, Levine ES, Kranzler HR, Abreu C and Covault J.
Journal Alcohol. Clin. Exp. Res. 36 (10), 1678-1687 (2012)
Title [Chromosomal instability, microsatellite instability and CpG island methylator phenotype: roles in small intestinal carcinogenesis] .
Author Blaker H, Warth A, Kloor M and Schirmacher P.
Journal Pathologe 32 (SUPPL 2), 181-184 (2011)
Title Rare mutations in N-methyl-D-aspartate glutamate receptors in autism spectrum disorders and schizophrenia .
Author Tarabeux J, Kebir O, Gauthier J, Hamdan FF, Xiong L, Piton A, Spiegelman D, Henrion E, Millet B, Fathalli F, Joober R, Rapoport JL, DeLisi LE, Fombonne E, Mottron L, Forget-Dubois N, Boivin M, Michaud JL, Drapeau P, Lafreniere RG, Rouleau GA and Krebs MO.
Journal Transl Psychiatry 1, E55 (2011)
Title Association analysis of the glutamic acid decarboxylase 2 and the glutamine synthetase genes (GAD2, GLUL) with schizophrenia .
Author Arai S, Shibata H, Sakai M, Ninomiya H, Iwata N, Ozaki N and Fukumaki Y.
Journal Psychiatr. Genet. 19 (1), 6-13 (2009)
Title Neurotransmission and bipolar disorder: a systematic family-based association study .
Author Shi J, Badner JA, Hattori E, Potash JB, Willour VL, McMahon FJ, Gershon ES and Liu C.
Journal Am. J. Med. Genet. B Neuropsychiatr. Genet. 147B (7), 1270-1277 (2008)
Title Expression of Ca2+/calmodulin-dependent protein kinase types II and IV, and reduced DNA synthesis due to the Ca2+/calmodulin-dependent protein kinase inhibitor KN-62 (1-[N,O-bis(5-isoquinolinesulfonyl)-N-methyl-L-tyrosyl]-4-phenyl piperazine) in small cell lung carcinoma .
Author Williams CL, Phelps SH and Porter RA.
Journal Biochem. Pharmacol. 51 (5), 707-715 (1996)
Title Selective alterations in gene expression for NMDA receptor subunits in prefrontal cortex of schizophrenics .
Author Akbarian S, Sucher NJ, Bradley D, Tafazzoli A, Trinh D, Hetrick WP, Potkin SG, Sandman CA, Bunney WE Jr and Jones EG.
Journal J. Neurosci. 16 (1), 19-30 (1996)
Title Developmental rearrangements of cortical glutamate-NMDA receptor binding sites in late human gestation .
Author Andersen DL, Tannenberg AE, Burke CJ and Dodd PR.
Journal Brain Res. Dev. Brain Res. 88 (2), 178-185 (1995)
Title Domain interaction between NMDA receptor subunits and the postsynaptic density protein PSD-95 .
Author Kornau HC, Schenker LT, Kennedy MB and Seeburg PH.
Journal Science 269 (5231), 1737-1740 (1995)
Title Human immunodeficiency virus type 1 tat activates non-N-methyl-D-aspartate excitatory amino acid receptors and causes neurotoxicity .
Author Magnuson DS, Knudsen BE, Geiger JD, Brownstone RM and Nath A.
Journal Ann. Neurol. 37 (3), 373-380 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.