• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_000860 Homo sapiens hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 1, mRNA. ORF Sequence $232.29
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000860.5, 372624400
Length 3044 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 1, mRNA.
Product 15-hydroxyprostaglandin dehydrogenase [NAD(+)] isoform 1
Comment

Summary: This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longer isoform (1).

RefSeq NP_000851.2
CDS 448..1248
Misc Feature(1)277..279
Misc Feature(2)448..1182
Misc Feature(3)448..1182
Misc Feature(4)463..1209
Misc Feature(5)order(481..483,487..498,553..561,634..645,718..729,
Misc Feature(6)order(745..750,757..759,769..774,781..786,793..795,
Misc Feature(7)order(766..768,859..861,898..900,910..912)
Exon (1)1..540
Gene:HPGD
Gene Synonym:15-PGDH; PGDH; PGDH1; PHOAR1; SDR36C1
Exon (2)541..664
Gene:HPGD
Gene Synonym:15-PGDH; PGDH; PGDH1; PHOAR1; SDR36C1
Exon (3)665..771
Gene:HPGD
Gene Synonym:15-PGDH; PGDH; PGDH1; PHOAR1; SDR36C1
Exon (4)772..868
Gene:HPGD
Gene Synonym:15-PGDH; PGDH; PGDH1; PHOAR1; SDR36C1
Exon (5)869..945
Gene:HPGD
Gene Synonym:15-PGDH; PGDH; PGDH1; PHOAR1; SDR36C1
Exon (6)946..1109
Gene:HPGD
Gene Synonym:15-PGDH; PGDH; PGDH1; PHOAR1; SDR36C1
Exon (7)1110..3027
Gene:HPGD
Gene Synonym:15-PGDH; PGDH; PGDH1; PHOAR1; SDR36C1
Translation MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLF IQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLD YMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNA ICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNG AIMKITTSKGIHFQDYDTTPFQAKTQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(44)-dbSNP:
complement(44)-g, cdbSNP:1346271
complement(59)-g, adbSNP:17524430
complement(146)-g, adbSNP:145977377
complement(227)-t, g, cdbSNP:116796476
complement(381)-g, adbSNP:45472095
complement(499)-c, adbSNP:200493851
complement(595)-dbSNP:
complement(595)-g, cdbSNP:1050143
complement(603)-g, adbSNP:1050145
complement(648)-t, gdbSNP:139780215
complement(654)-t, cdbSNP:146392763
complement(667)-dbSNP:
complement(667)-t, cdbSNP:142173308
complement(731)-t, cdbSNP:199975458
complement(746)-g, cdbSNP:138883930
complement(816)-dbSNP:
complement(816)-g, adbSNP:201924339
complement(824)-t, cdbSNP:201524759
complement(837)-g, adbSNP:150657451
complement(840)-g, adbSNP:141902184
complement(865)-g, cdbSNP:121434480
complement(871)-dbSNP:
complement(871)-g, adbSNP:199512526
complement(879)-g, adbSNP:148100548
complement(880)-t, cdbSNP:139715202
complement(934)-g, adbSNP:181587981
complement(936)-g, adbSNP:17060544
complement(945)-t, cdbSNP:200828629
complement(948)-dbSNP:
complement(948)-c, adbSNP:202175053
complement(961)-t, cdbSNP:138960809
complement(967)-t, gdbSNP:200207595
complement(969)-g, adbSNP:146971052
complement(972)-g, adbSNP:142237506
complement(973)-t, cdbSNP:187367875
complement(1024)-t, cdbSNP:121434481
complement(1057)-t, cdbSNP:145014353
complement(1081)-t, cdbSNP:148874494
complement(1097)-t, cdbSNP:140209262
complement(1102)-t, adbSNP:201125673
complement(1127)-dbSNP:
complement(1127)-t, cdbSNP:117270501
complement(1168)-t, cdbSNP:200576175
complement(1207)-t, gdbSNP:151167308
complement(1224..1225)-, cdbSNP:34394742
complement(1242..1243)-, gdbSNP:35657904
complement(1276)-g, adbSNP:11548753
complement(1289)-t, cdbSNP:201828747
complement(1305)-g, adbSNP:112738356
complement(1335)-g, adbSNP:45522334
complement(1343)-g, cdbSNP:186313653
complement(1380)-g, adbSNP:2253170
complement(1455)-t, cdbSNP:181290362
complement(1578)-t, cdbSNP:188965140
complement(1666)-t, gdbSNP:2253270
complement(1686)-t, cdbSNP:144520232
complement(1766)-c, adbSNP:184599219
complement(1781)-g, cdbSNP:181718001
complement(1806)-t, cdbSNP:11548752
complement(1851..1854)-, atcadbSNP:59465956
complement(1854..1857)-, ttgadbSNP:45618536
complement(1878)-g, adbSNP:8752
complement(1957)-t, gdbSNP:140692963
complement(2064..2066)-, aagdbSNP:145594780
complement(2078)-g, cdbSNP:111450188
complement(2124)-t, cdbSNP:146877951
complement(2186..2187)-, gdbSNP:140501435
complement(2282)-t, cdbSNP:190309927
complement(2314)-t, cdbSNP:185881768
complement(2402)-g, adbSNP:9312555
complement(2480)-c, adbSNP:143839580
complement(2558)-c, adbSNP:75326644
complement(2754)-t, cdbSNP:192287521
complement(2762)-g, adbSNP:45449496
complement(2796)-t, cdbSNP:145265762
complement(2814)-t, gdbSNP:150001633
complement(2827)-t, gdbSNP:187895645
complement(2873)-t, cdbSNP:183807404
complement(2891)-t, cdbSNP:191760831
complement(2945)-t, cdbSNP:187248166
complement(2973)-t, cdbSNP:2555660
complement(2974)-g, adbSNP:2612691
complement(2999)-t, adbSNP:13104730
Gene SymbolHPGD
Gene Synonym15-PGDH; PGDH; PGDH1; PHOAR1; SDR36C1
Chromosome4
Locus Map4q34-q35
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000860 Homo sapiens hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 1, mRNA. Full Length $1065.40
ORF Sequence $232.29
NM_001145816 Homo sapiens hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 2, mRNA. Full Length $835.20
ORF Sequence $159.00
NM_001256301 Homo sapiens hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 3, mRNA. Full Length $804.46
ORF Sequence $159.00
NM_001256305 Homo sapiens hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 4, mRNA. Full Length $812.87
ORF Sequence $159.00
NM_001256306 Homo sapiens hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 5, mRNA. Full Length $823.60
ORF Sequence $173.13
NM_001256307 Homo sapiens hydroxyprostaglandin dehydrogenase 15-(NAD) (HPGD), transcript variant 6, mRNA. Full Length $851.73
ORF Sequence $159.00
Title beta-catenin represses expression of the tumour suppressor 15-prostaglandin dehydrogenase in the normal intestinal epithelium and colorectal tumour cells .
Author Smartt,H.J., Greenhough,A., Ordonez-Moran,P., Talero,E., Cherry,C.A., Wallam,C.A., Parry,L., Al Kharusi,M., Roberts,H.R., Mariadason,J.M., Clarke,A.R., Huelsken,J., Williams,A.C. and Paraskeva,C.
Journal Gut 61 (9), 1306-1314 (2012)
Title 15-PGDH is reduced and induces apoptosis and cell cycle arrest in gastric carcinoma .
Author Lou,L.H., Jing,D.D., Lai,Y.X., Lu,Y.Y., Li,J.K. and Wu,K.
Journal World J. Gastroenterol. 18 (10), 1028-1037 (2012)
Title 15-Hydroxyprostaglandin dehydrogenase associates with poor prognosis in breast cancer, induces epithelial-mesenchymal transition, and promotes cell migration in cultured breast cancer cells .
Author Lehtinen,L., Vainio,P., Wikman,H., Reemts,J., Hilvo,M., Issa,R., Pollari,S., Brandt,B., Oresic,M., Pantel,K., Kallioniemi,O. and Iljin,K.
Journal J. Pathol. 226 (4), 674-686 (2012)
Title Protein tyrosine nitration of 15-hydroxy prostaglandin dehydrogenase in the human mast cell line LAD2 .
Author Sekar,Y. and Befus,A.D.
Journal Nitric Oxide 26 (1), 74-80 (2012)
Title 15-hydroxyprostaglandin dehydrogenase is downregulated and exhibits tumor suppressor activity in gastric cancer .
Author Song,H.J., Myung,S.J., Kim,I.W., Jeong,J.Y., Park,Y.S., Lee,S.M., Nam,W.H., Ryu,Y.M., Fink,S.P., Yang,D.H., Jung,H.Y. and Kim,J.H.
Journal Cancer Invest. 29 (4), 257-265 (2011)
Title Sequence of a novel mRNA coding for a C-terminal-truncated form of human NAD(+)-dependent 15-hydroxyprostaglandin dehydrogenase .
Author Pichaud,F., Frendo,J.L., Delage-Mourroux,R., de Vernejoul,M.C., Moukhtar,M.S. and Jullienne,A.
Journal Gene 162 (2), 319-322 (1995)
Title Placental localization of 15-hydroxy-prostaglandin dehydrogenase in early and term human pregnancy .
Author Erwich,J.J. and Keirse,M.J.
Journal Placenta 13 (3), 223-229 (1992)
Title Site-directed mutagenesis of the conserved tyrosine 151 of human placental NAD(+)-dependent 15-hydroxyprostaglandin dehydrogenase yields a catalytically inactive enzyme .
Author Ensor,C.M. and Tai,H.H.
Journal Biochem. Biophys. Res. Commun. 176 (2), 840-845 (1991)
Title Cloning and sequence analysis of the cDNA for human placental NAD(+)-dependent 15-hydroxyprostaglandin dehydrogenase .
Author Ensor,C.M., Yang,J.Y., Okita,R.T. and Tai,H.H.
Journal J. Biol. Chem. 265 (25), 14888-14891 (1990)
Title Purification and structural characterization of placental NAD(+)-linked 15-hydroxyprostaglandin dehydrogenase. The primary structure reveals the enzyme to belong to the short-chain alcohol dehydrogenase family .
Author Krook,M., Marekov,L. and Jornvall,H.
Journal Biochemistry 29 (3), 738-743 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878