• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 2 receptor, beta (IL2RB), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu15617 Homo sapiens interleukin 2 receptor, beta (IL2RB), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu15617C Homo sapiens interleukin 2 receptor, beta (IL2RB), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000878.3, 390979670
Length 1656 bp
Structure linear
Update Date 12-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 2 receptor, beta (IL2RB), mRNA.
Product interleukin-2 receptor subunit beta precursor
Comment

Summary: The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high affinity form consists of an alpha/beta/gamma subunit heterotrimer. Both the intermediate and high affinity forms of the receptor are involved in receptor-mediated endocytosis and transduction of mitogenic signals from interleukin 2. The protein encoded by this gene represents the beta subunit and is a type I membrane protein. [provided by RefSeq, Jul 2008].

RefSeq NP_000869.1
CDS 132..1787
Misc Feature(1)531..824
Misc Feature(2)order(729..731,774..776)
Misc Feature(3)789..803
Misc Feature(4)order(789..794,798..803)
Misc Feature(5)852..926
Misc Feature(6)963..989
Misc Feature(7)1221..1223
Misc Feature(8)1272..1274
Misc Feature(9)1281..1283
Misc Feature(10)1290..1292
Misc Feature(11)1383..1385
Misc Feature(12)1737..1739
Exon (1)1..98
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (2)99..219
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (3)220..334
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (4)335..413
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (5)414..519
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (6)520..668
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (7)669..834
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (8)835..949
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (9)950..1034
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (10)1035..4045
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Translation MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQ VHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMA IQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEE APLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT IPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFT NQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCT FPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVP DLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQ ELQGQDPTHLV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(30)-dbSNP:
complement(30)-c, adbSNP:371187476
complement(49)-g, adbSNP:112662718
complement(68)-t, cdbSNP:150921267
complement(71)-t, cdbSNP:3218250
complement(81)-t, cdbSNP:368382925
complement(111)-dbSNP:
complement(111)-g, adbSNP:183183988
complement(145)-g, cdbSNP:148235304
complement(156)-g, adbSNP:143132364
complement(157)-t, cdbSNP:147593802
complement(159)-g, cdbSNP:57770674
complement(176)-g, adbSNP:377485257
complement(195)-g, adbSNP:145316401
complement(205)-t, gdbSNP:6000577
complement(211)-g, adbSNP:141522549
complement(229)-dbSNP:
complement(229)-t, cdbSNP:147889445
complement(251)-t, cdbSNP:114542628
complement(257)-g, adbSNP:148800183
complement(315)-g, adbSNP:185863845
complement(317)-g, adbSNP:374479635
complement(325)-g, adbSNP:371340355
complement(326)-t, cdbSNP:150659506
complement(333)-g, adbSNP:375594279
complement(336)-dbSNP:
complement(336)-g, cdbSNP:117728347
complement(356)-g, cdbSNP:113714217
complement(365)-g, adbSNP:111730897
complement(366)-t, cdbSNP:149508414
complement(379)-t, cdbSNP:2228143
complement(406)-t, gdbSNP:183884204
complement(428)-dbSNP:
complement(428)-g, adbSNP:117987928
complement(440)-g, adbSNP:200052713
complement(462)-g, adbSNP:369774326
complement(463)-t, cdbSNP:137877148
complement(475)-t, cdbSNP:375543770
complement(519)-t, g, adbSNP:146185118
complement(532)-dbSNP:
complement(532)-g, adbSNP:201441730
complement(590)-t, gdbSNP:149258462
complement(602)-g, adbSNP:371794346
complement(630)-g, adbSNP:200381499
complement(644)-t, cdbSNP:138490007
complement(649)-t, gdbSNP:368501031
complement(713)-dbSNP:
complement(713)-g, adbSNP:369748788
complement(721)-g, adbSNP:143330463
complement(734)-t, gdbSNP:140822038
complement(737)-g, cdbSNP:375725531
complement(765)-g, adbSNP:138141902
complement(819)-t, cdbSNP:147009331
complement(835)-dbSNP:
complement(835)-g, adbSNP:375780607
complement(876)-c, adbSNP:147866253
881+c, tdbSNP:228953
complement(887)-g, adbSNP:200064374
complement(906)-t, cdbSNP:140720297
complement(938)-g, adbSNP:201360122
complement(941)-g, adbSNP:115475423
complement(942)-t, cdbSNP:116250343
complement(963)-dbSNP:
complement(963)-g, adbSNP:9610653
complement(972)-t, cdbSNP:369612891
complement(1016)-c, adbSNP:139692590
complement(1063)-dbSNP:
complement(1063)-g, adbSNP:376447587
complement(1064)-t, cdbSNP:371694691
complement(1079)-g, adbSNP:146858997
complement(1080)-t, cdbSNP:143857582
complement(1115)-t, cdbSNP:140182148
complement(1132)-g, adbSNP:146173891
complement(1149)-t, gdbSNP:141159874
complement(1166)-t, cdbSNP:374025450
complement(1188)-g, adbSNP:148621370
complement(1190)-g, adbSNP:143940767
complement(1240)-g, adbSNP:148074427
complement(1240)-g, adbSNP:386438452
complement(1261)-g, cdbSNP:149497090
complement(1283)-g, adbSNP:146986731
complement(1284)-t, cdbSNP:182482913
complement(1288)-g, cdbSNP:142845071
1304+a, cdbSNP:228942
complement(1322)-g, adbSNP:150175464
complement(1323)-t, cdbSNP:188869923
complement(1342)-g, adbSNP:374625831
complement(1364)-g, cdbSNP:200663995
complement(1376)-g, adbSNP:151048201
complement(1379)-g, adbSNP:185969164
complement(1427)-t, g, adbSNP:143704470
complement(1440)-t, cdbSNP:181177639
complement(1463)-g, adbSNP:375951025
complement(1479)-t, cdbSNP:371167679
complement(1490)-c, adbSNP:199581476
complement(1535)-g, adbSNP:35134562
complement(1536)-g, adbSNP:200339234
complement(1544)-g, adbSNP:188695948
complement(1558)-g, adbSNP:201428524
complement(1559)-g, cdbSNP:202199075
complement(1607)-t, cdbSNP:369066989
complement(1624..1625)-, tdbSNP:34283988
complement(1637)-g, adbSNP:200168333
complement(1678)-g, adbSNP:200831371
complement(1713)-g, adbSNP:377234631
complement(1783)-g, adbSNP:147038391
complement(1831)-t, cdbSNP:3218326
complement(1844)-t, cdbSNP:376035267
complement(1879)-t, cdbSNP:3218327
complement(1915)-g, adbSNP:3218328
complement(1915)-g, adbSNP:386581117
complement(1930)-t, gdbSNP:184918997
complement(2062)-g, adbSNP:192146486
complement(2087)-g, cdbSNP:76794334
complement(2139)-, cdbSNP:34875471
complement(2159)-t, gdbSNP:189536875
2202+c, gdbSNP:228941
2231+a, cdbSNP:3218329
complement(2250)-t, cdbSNP:374788096
2259+a, c, tdbSNP:3218330
complement(2259)-c, adbSNP:386581118
complement(2287)-t, cdbSNP:185417988
complement(2299)-t, cdbSNP:192627099
complement(2322)-t, cdbSNP:3218331
complement(2433)-t, adbSNP:3218365
complement(2438)-g, cdbSNP:41309804
2492+g, tdbSNP:3218332
complement(2603)-t, cdbSNP:228940
2617+a, tdbSNP:3218366
complement(2651)-t, cdbSNP:386438291
complement(2651)-g, adbSNP:41309802
complement(2675..2676)-, ccdbSNP:140647613
complement(2677)-t, cdbSNP:55874649
complement(2713)-c, adbSNP:113775198
complement(2818)-t, cdbSNP:148887561
complement(2874..2875)-, gdbSNP:35536547
complement(2895)-g, adbSNP:228939
complement(2899)-t, cdbSNP:370322848
complement(3116)-g, cdbSNP:145621853
complement(3144)-t, cdbSNP:367989504
complement(3158)-c, adbSNP:228938
complement(3216)-t, cdbSNP:114845216
3233+c, tdbSNP:149733695
complement(3274..3275)-, gdbSNP:112852512
complement(3275)-t, gdbSNP:139628494
complement(3398)-t, gdbSNP:111460079
complement(3486)-g, adbSNP:373988054
complement(3523)-c, adbSNP:183295072
3597+c, tdbSNP:146413240
3632+a, tdbSNP:3218367
complement(3646)-c, adbSNP:190679692
3650+c, tdbSNP:139174446
complement(3811)-c, adbSNP:186213678
complement(3867)-g, adbSNP:15696
complement(3926)-g, adbSNP:3218333
complement(3943)-t, cdbSNP:183158957
3990+a, cdbSNP:3218334
complement(3998)-g, adbSNP:191061260
Gene SymbolIL2RB
Gene SynonymCD122; IL15RB; P70-75
Chromosome22
Locus Map22q13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000878 Homo sapiens interleukin 2 receptor, beta (IL2RB), mRNA. On-demand $219.00 7-9
Title Genome-wide association study of ancestry-specific TB risk in the South African Coloured population .
Author Chimusa ER, Zaitlen N, Daya M, Moller M, van Helden PD, Mulder NJ, Price AL and Hoal EG.
Journal Hum. Mol. Genet. 23 (3), 796-809 (2014)
Title Chimeric gammac cytokine receptors confer cytokine independent engraftment of human T lymphocytes .
Author Hunter MR, Prosser ME, Mahadev V, Wang X, Aguilar B, Brown CE, Forman SJ and Jensen MC.
Journal Mol. Immunol. 56 (1-2), 1-11 (2013)
Title Postthymic expansion in human CD4 naive T cells defined by expression of functional high-affinity IL-2 receptors .
Author Pekalski ML, Ferreira RC, Coulson RM, Cutler AJ, Guo H, Smyth DJ, Downes K, Dendrou CA, Castro Dopico X, Esposito L, Coleman G, Stevens HE, Nutland S, Walker NM, Guy C, Dunger DB, Wallace C, Tree TI, Todd JA and Wicker LS.
Journal J. Immunol. 190 (6), 2554-2566 (2013)
Title Evaluation of the IL2/IL21, IL2RA and IL2RB genetic variants influence on the endogenous non-anterior uveitis genetic predisposition .
Author Cenit MC, Marquez A, Cordero-Coma M, Fonollosa A, Adan A, Martinez-Berriotxoa A, Llorenc V, Diaz Valle D, Blanco R, Canal J, Diaz-Llopis M, Garcia Serrano JL, de Ramon E, del Rio MJ, Begona Gorrono-Echebarria M, Martin-Villa JM, Ortego-Centeno N and Martin J.
Journal BMC Med. Genet. 14, 52 (2013)
Title Lack of association of IL-2RA and IL-2RB polymorphisms with rheumatoid arthritis in a Han Chinese population .
Author Zhu J, He F, Zhang DD, Yang JY, Cheng J, Wu R, Gong B, Liu XQ, Ma S and Zhou B.
Journal Genet. Mol. Res. 12 (1), 581-586 (2013)
Title Suppression of interleukin-2 and interleukin-2 receptor expression in Jurkat cells stably expressing the human immunodeficiency virus Tat protein .
Author Purvis SF, Georges DL, Williams TM and Lederman MM.
Journal Cell. Immunol. 144 (1), 32-42 (1992)
Title Interleukin-2 (IL-2) induces tyrosine kinase-dependent translocation of active raf-1 from the IL-2 receptor into the cytosol .
Author Maslinski W, Remillard B, Tsudo M and Strom TB.
Journal J. Biol. Chem. 267 (22), 15281-15284 (1992)
Title Interleukin 2 regulates the activity of the lyn protein-tyrosine kinase in a B-cell line .
Author Torigoe T, Saragovi HU and Reed JC.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (7), 2674-2678 (1992)
Title The integrity of the conserved 'WS motif' common to IL-2 and other cytokine receptors is essential for ligand binding and signal transduction .
Author Miyazaki T, Maruyama M, Yamada G, Hatakeyama M and Taniguchi T.
Journal EMBO J. 10 (11), 3191-3197 (1991)
Title The human interleukin-2 receptor beta-chain gene: genomic organization, promoter analysis and chromosomal assignment .
Author Shibuya H, Yoneyama M, Nakamura Y, Harada H, Hatakeyama M, Minamoto S, Kono T, Doi T, White R and Taniguchi T.
Journal Nucleic Acids Res. 18 (13), 3697-3703 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.