• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interleukin 2 receptor, beta (IL2RB), mRNA.


RefSeq Accession Definition Services Price Order
NM_000878 Homo sapiens interleukin 2 receptor, beta (IL2RB), mRNA. ORF Sequence $480.24
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000878.3, 390979670
Length 4050 bp
Structure linear
Update Date 20-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens interleukin 2 receptor, beta (IL2RB), mRNA.
Product interleukin-2 receptor subunit beta precursor
Comment

Summary: The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high affinity form consists of an alpha/beta/gamma subunit heterotrimer. Both the intermediate and high affinity forms of the receptor are involved in receptor-mediated endocytosis and transduction of mitogenic signals from interleukin 2. The protein encoded by this gene represents the beta subunit and is a type I membrane protein. [provided by RefSeq, Jul 2008].

RefSeq NP_000869.1
CDS 132..1787
Misc Feature(1)531..824
Misc Feature(2)order(729..731,774..776)
Misc Feature(3)789..803
Misc Feature(4)order(789..794,798..803)
Misc Feature(5)852..926
Misc Feature(6)963..989
Misc Feature(7)1221..1223
Misc Feature(8)1272..1274
Misc Feature(9)1281..1283
Misc Feature(10)1290..1292
Misc Feature(11)1383..1385
Misc Feature(12)1737..1739
Exon (1)1..98
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (2)99..219
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (3)220..334
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (4)335..413
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (5)414..519
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (6)520..668
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (7)669..834
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (8)835..949
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (9)950..1034
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Exon (10)1035..4045
Gene:IL2RB
Gene Synonym:CD122; IL15RB; P70-75
Translation MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQ VHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMA IQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEE APLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT IPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFT NQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCT FPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVP DLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQ ELQGQDPTHLV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(49)-dbSNP:
complement(49)-g, adbSNP:112662718
complement(68)-t, cdbSNP:150921267
complement(71)-t, cdbSNP:3218250
complement(111)-dbSNP:
complement(111)-g, adbSNP:183183988
complement(145)-g, cdbSNP:148235304
complement(156)-g, adbSNP:143132364
complement(157)-t, cdbSNP:147593802
complement(159)-g, cdbSNP:57770674
complement(195)-g, adbSNP:145316401
complement(205)-t, gdbSNP:6000577
complement(211)-g, adbSNP:141522549
complement(229)-dbSNP:
complement(229)-t, cdbSNP:147889445
complement(251)-t, cdbSNP:114542628
complement(257)-g, adbSNP:148800183
complement(315)-g, adbSNP:185863845
complement(326)-t, cdbSNP:150659506
complement(336)-dbSNP:
complement(336)-g, cdbSNP:117728347
complement(354)-g, cdbSNP:142930894
complement(356)-g, cdbSNP:113714217
complement(365)-g, adbSNP:111730897
complement(366)-t, cdbSNP:149508414
complement(379)-t, cdbSNP:2228143
complement(406)-t, gdbSNP:183884204
complement(428)-dbSNP:
complement(428)-g, adbSNP:117987928
complement(440)-g, adbSNP:200052713
complement(463)-t, cdbSNP:137877148
complement(519)-t, g, adbSNP:146185118
complement(532)-dbSNP:
complement(532)-g, adbSNP:201441730
complement(590)-t, gdbSNP:149258462
complement(630)-g, adbSNP:200381499
complement(644)-t, cdbSNP:138490007
complement(721)-dbSNP:
complement(721)-g, adbSNP:143330463
complement(734)-t, gdbSNP:140822038
complement(765)-g, adbSNP:138141902
complement(819)-t, cdbSNP:147009331
complement(864)-dbSNP:
complement(864)-t, cdbSNP:141482021
complement(876)-c, adbSNP:147866253
complement(881)-t, cdbSNP:228953
complement(887)-g, adbSNP:200064374
complement(906)-t, cdbSNP:140720297
complement(938)-g, adbSNP:201360122
complement(941)-g, adbSNP:115475423
complement(942)-t, cdbSNP:116250343
complement(963)-dbSNP:
complement(963)-g, adbSNP:9610653
complement(1016)-c, adbSNP:139692590
complement(1079)-dbSNP:
complement(1079)-g, adbSNP:146858997
complement(1080)-t, cdbSNP:143857582
complement(1115)-t, cdbSNP:140182148
complement(1132)-g, adbSNP:146173891
complement(1149)-t, gdbSNP:141159874
complement(1188)-g, adbSNP:148621370
complement(1190)-g, adbSNP:143940767
complement(1240)-g, adbSNP:148074427
complement(1261)-g, cdbSNP:149497090
complement(1270)-g, adbSNP:138108441
complement(1283)-g, adbSNP:146986731
complement(1284)-t, cdbSNP:182482913
complement(1288)-g, cdbSNP:142845071
complement(1304)-c, adbSNP:228942
complement(1322)-g, adbSNP:150175464
complement(1323)-t, cdbSNP:188869923
complement(1352)-t, gdbSNP:140923067
complement(1364)-g, cdbSNP:200663995
complement(1376)-g, adbSNP:151048201
complement(1379)-g, adbSNP:185969164
complement(1427)-t, g, adbSNP:143704470
complement(1440)-t, cdbSNP:181177639
complement(1490)-c, adbSNP:199581476
complement(1535)-g, adbSNP:35134562
complement(1536)-g, adbSNP:200339234
complement(1544)-g, adbSNP:188695948
complement(1558)-g, adbSNP:201428524
complement(1559)-g, cdbSNP:202199075
complement(1624..1625)-, tdbSNP:34283988
complement(1637)-g, adbSNP:200168333
complement(1678)-g, adbSNP:200831371
complement(1783)-g, adbSNP:147038391
complement(1831)-t, cdbSNP:3218326
complement(1879)-t, cdbSNP:3218327
complement(1915)-g, adbSNP:3218328
complement(1930)-t, gdbSNP:184918997
complement(2062)-g, adbSNP:192146486
complement(2087)-g, cdbSNP:76794334
complement(2139)-, cdbSNP:34875471
complement(2159)-t, gdbSNP:189536875
complement(2202)-g, cdbSNP:228941
complement(2231)-c, adbSNP:3218329
complement(2259)-t, c, adbSNP:3218330
complement(2287)-t, cdbSNP:185417988
complement(2299)-t, cdbSNP:192627099
complement(2322)-t, cdbSNP:3218331
complement(2433)-t, adbSNP:3218365
complement(2438)-g, cdbSNP:41309804
complement(2492)-t, gdbSNP:3218332
complement(2603)-t, cdbSNP:228940
complement(2617)-t, adbSNP:3218366
complement(2651)-g, adbSNP:41309802
complement(2675..2676)-, ccdbSNP:140647613
complement(2677)-t, cdbSNP:55874649
complement(2713)-c, adbSNP:113775198
complement(2818)-t, cdbSNP:148887561
complement(2875..2876)-, gdbSNP:35536547
complement(2895)-g, adbSNP:228939
complement(3116)-g, cdbSNP:145621853
complement(3158)-c, adbSNP:228938
complement(3216)-t, cdbSNP:114845216
complement(3233)-t, cdbSNP:149733695
complement(3275..3276)-, gdbSNP:112852512
complement(3275)-t, gdbSNP:139628494
complement(3398)-t, gdbSNP:111460079
complement(3523)-c, adbSNP:183295072
complement(3597)-t, cdbSNP:146413240
complement(3632)-t, adbSNP:3218367
complement(3646)-c, adbSNP:190679692
complement(3650)-t, cdbSNP:139174446
complement(3811)-c, adbSNP:186213678
complement(3867)-g, adbSNP:15696
complement(3926)-g, adbSNP:3218333
complement(3943)-t, cdbSNP:183158957
complement(3990)-c, adbSNP:3218334
complement(3998)-g, adbSNP:191061260
Gene SymbolIL2RB
Gene SynonymCD122; IL15RB; P70-75
Chromosome22
Locus Map22q13.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000878 Homo sapiens interleukin 2 receptor, beta (IL2RB), mRNA. Full Length $1417.50
ORF Sequence $480.24
Title Multistage analysis of variants in the inflammation pathway and lung cancer risk in smokers .
Author Spitz,M.R., Gorlov,I.P., Dong,Q., Wu,X., Chen,W., Chang,D.W., Etzel,C.J., Caporaso,N.E., Zhao,Y., Christiani,D.C., Brennan,P., Albanes,D., Shi,J., Thun,M., Landi,M.T. and Amos,C.I.
Journal Cancer Epidemiol. Biomarkers Prev. 21 (7), 1213-1221 (2012)
Title Soluble cytokine receptors (sIL-2Ralpha, sIL-2Rbeta) induce subunit-specific behavioral responses and accumulate in the cerebral cortex and basal forebrain .
Author Zalcman,S.S., Patel,A., Mohla,R., Zhu,Y. and Siegel,A.
Journal PLoS ONE 7 (4), E36316 (2012)
Title The basis of distinctive IL-2- and IL-15-dependent signaling: weak CD122-dependent signaling favors CD8+ T central-memory cell survival but not T effector-memory cell development .
Author Castro,I., Yu,A., Dee,M.J. and Malek,T.R.
Journal J. Immunol. 187 (10), 5170-5182 (2011)
Title Placenta-specific expression of the interleukin-2 (IL-2) receptor beta subunit from an endogenous retroviral promoter .
Author Cohen,C.J., Rebollo,R., Babovic,S., Dai,E.L., Robinson,W.P. and Mager,D.L.
Journal J. Biol. Chem. 286 (41), 35543-35552 (2011)
Title Impact of IL2 and IL2RB genetic polymorphisms in kidney transplantation .
Author Park,S.J., Yoon,Y.C., Kang,S.W., Kim,T.H., Kim,Y.W., Joo,H., Kim,H.J., Jeong,K.H., Lee,D.Y., Lee,S.S., Chung,J.H. and Kim,Y.H.
Journal Transplant. Proc. 43 (6), 2383-2387 (2011)
Title Suppression of interleukin-2 and interleukin-2 receptor expression in Jurkat cells stably expressing the human immunodeficiency virus Tat protein .
Author Purvis,S.F., Georges,D.L., Williams,T.M. and Lederman,M.M.
Journal Cell. Immunol. 144 (1), 32-42 (1992)
Title Interleukin-2 (IL-2) induces tyrosine kinase-dependent translocation of active raf-1 from the IL-2 receptor into the cytosol .
Author Maslinski,W., Remillard,B., Tsudo,M. and Strom,T.B.
Journal J. Biol. Chem. 267 (22), 15281-15284 (1992)
Title Interleukin 2 regulates the activity of the lyn protein-tyrosine kinase in a B-cell line .
Author Torigoe,T., Saragovi,H.U. and Reed,J.C.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (7), 2674-2678 (1992)
Title The integrity of the conserved 'WS motif' common to IL-2 and other cytokine receptors is essential for ligand binding and signal transduction .
Author Miyazaki,T., Maruyama,M., Yamada,G., Hatakeyama,M. and Taniguchi,T.
Journal EMBO J. 10 (11), 3191-3197 (1991)
Title The human interleukin-2 receptor beta-chain gene: genomic organization, promoter analysis and chromosomal assignment .
Author Shibuya,H., Yoneyama,M., Nakamura,Y., Harada,H., Hatakeyama,M., Minamoto,S., Kono,T., Doi,T., White,R. and Taniguchi,T.
Journal Nucleic Acids Res. 18 (13), 3697-3703 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878